SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1a0gA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1a0gA
Domain Number 1 Region: 6-273
Classification Level Classification E-value
Superfamily D-aminoacid aminotransferase-like PLP-dependent enzymes 1.78e-108
Family D-aminoacid aminotransferase-like PLP-dependent enzymes 0.00000000942
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1a0gA   PDB: 1a0g   SUPERFAMILY: 1a0gA
Sequence length 282
Comment (A:)
Sequence
gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtegss
snvfgikdgilythpannmiakgitrdvviacaneinmpvkeipftthealkmdelfvts
ttseitpvieidgklirdgkvgewtrklqkqfetkipkplhi
Download sequence
Identical sequences 1a0gA 1a0g_A 1a0g_B 2dab_A 2dab_B d1a0gb_ d2dabb_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]