SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1a1zA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1a1zA
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily DEATH domain 2.64e-25
Family DEATH effector domain, DED 0.00000674
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1a1zA   PDB: 1a1z   SUPERFAMILY: 1a1zA
Sequence length 91
Comment (A:)
Sequence
mdpflvllhsvssslssseltelkglclgrvgkrklervqsgldlfsmlleqndlepght
ellrellaslrrhdllrrvddfelehhhhhh
Download sequence
Identical sequences 1a1zA cath|current|1a1zA00/1-83 1a1z_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]