SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1a2oA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1a2oA
Domain Number 1 Region: 156-342
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.9e-76
Family Methylesterase CheB, C-terminal domain 0.00000000648
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 8.3e-28
Family CheY-related 0.0000659
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1a2oA   PDB: 1a2o
Sequence length 349
Comment (A:)
Sequence
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYS
EMIAEKVRTAARARIAAHKPMAAPTTLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPAVIITQHMPPGFTRSFAERLNKLCQISVKEAEDGERVLPGHAYIAPGDKHMELARSG
ANYQIKIHDGPPVNRHRPSVDVLFHSVAKHAGRNAVGVILTGMGNDGAAGMLAMYQAGAW
TIAQNEASCVVFGMPREAINMGGVSEVVDLSQVSQQMLAKISAGQAIRI
Download sequence
Identical sequences A0A0F6B2Q0 A0A0F7J7E6 A0A0H3NCE6 A0A0M2IVB2 A0A0T7RYQ0 A0A0U1K3M3 A0A0W3Y6E0 A0A1S1AQD7 A0A1X2UQD8 A0A221YLX3 A0A221YZ58 A0A249UXQ4 A0A267SI18 A0A271CT30 A0A2D1XDD2 A0A2D3ACW3 A0A2G1P766 A0A2H9YCG3 B5F2W8 E8XA65 G5NBN1 P04042 Q5PMY3 S5HM25 V7IFY0
gi|197362089|ref|YP_002141726.1| gi|482903738|ref|YP_007902298.1| gi|29141442|ref|NP_804784.1| gi|526220493|ref|YP_008266125.1| NP_460874.1.58477 WP_000036392.1.100007 WP_000036392.1.100008 WP_000036392.1.100010 WP_000036392.1.100031 WP_000036392.1.100036 WP_000036392.1.100079 WP_000036392.1.100115 WP_000036392.1.10013 WP_000036392.1.100196 WP_000036392.1.1002 WP_000036392.1.100234 WP_000036392.1.100258 WP_000036392.1.100284 WP_000036392.1.100313 WP_000036392.1.100314 WP_000036392.1.100321 WP_000036392.1.100354 WP_000036392.1.100376 WP_000036392.1.100421 WP_000036392.1.100424 WP_000036392.1.100436 WP_000036392.1.100438 WP_000036392.1.100446 WP_000036392.1.100450 WP_000036392.1.100484 WP_000036392.1.100488 WP_000036392.1.100521 WP_000036392.1.100592 WP_000036392.1.100597 WP_000036392.1.100610 WP_000036392.1.10065 WP_000036392.1.100707 WP_000036392.1.100721 WP_000036392.1.100732 WP_000036392.1.100733 WP_000036392.1.100739 WP_000036392.1.10074 WP_000036392.1.10076 WP_000036392.1.100764 WP_000036392.1.100773 WP_000036392.1.100790 WP_000036392.1.100793 WP_000036392.1.100799 WP_000036392.1.100865 WP_000036392.1.100869 WP_000036392.1.100871 WP_000036392.1.100882 WP_000036392.1.100932 WP_000036392.1.100941 WP_000036392.1.100944 WP_000036392.1.100953 WP_000036392.1.101007 WP_000036392.1.101011 WP_000036392.1.101020 WP_000036392.1.101074 WP_000036392.1.101078 WP_000036392.1.10108 WP_000036392.1.101094 WP_000036392.1.101111 WP_000036392.1.101126 WP_000036392.1.101180 WP_000036392.1.101199 WP_000036392.1.101226 WP_000036392.1.101239 WP_000036392.1.10124 WP_000036392.1.101259 WP_000036392.1.101271 WP_000036392.1.101284 WP_000036392.1.101291 WP_000036392.1.101312 WP_000036392.1.101320 WP_000036392.1.101322 WP_000036392.1.101353 WP_000036392.1.101374 WP_000036392.1.101386 WP_000036392.1.101404 WP_000036392.1.101420 WP_000036392.1.101454 WP_000036392.1.101473 WP_000036392.1.101519 WP_000036392.1.101589 WP_000036392.1.101609 WP_000036392.1.101616 WP_000036392.1.101636 WP_000036392.1.101639 WP_000036392.1.101707 WP_000036392.1.101734 WP_000036392.1.101741 WP_000036392.1.101759 WP_000036392.1.101815 WP_000036392.1.101839 WP_000036392.1.101878 WP_000036392.1.101890 WP_000036392.1.101904 WP_000036392.1.101941 WP_000036392.1.101949 WP_000036392.1.101953 WP_000036392.1.101975 WP_000036392.1.102009 WP_000036392.1.102050 WP_000036392.1.102087 WP_000036392.1.10220 WP_000036392.1.10266 WP_000036392.1.10276 WP_000036392.1.10310 WP_000036392.1.10338 WP_000036392.1.1038 WP_000036392.1.10394 WP_000036392.1.104 WP_000036392.1.10401 WP_000036392.1.10428 WP_000036392.1.10429 WP_000036392.1.10439 WP_000036392.1.10459 WP_000036392.1.10465 WP_000036392.1.10475 WP_000036392.1.10507 WP_000036392.1.10511 WP_000036392.1.10514 WP_000036392.1.10530 WP_000036392.1.10532 WP_000036392.1.10547 WP_000036392.1.10562 WP_000036392.1.10595 WP_000036392.1.10642 WP_000036392.1.10654 WP_000036392.1.10677 WP_000036392.1.10678 WP_000036392.1.10711 WP_000036392.1.10753 WP_000036392.1.10797 WP_000036392.1.10857 WP_000036392.1.10873 WP_000036392.1.10926 WP_000036392.1.10936 WP_000036392.1.10992 WP_000036392.1.11000 WP_000036392.1.11012 WP_000036392.1.11024 WP_000036392.1.11031 WP_000036392.1.11055 WP_000036392.1.11098 WP_000036392.1.11126 WP_000036392.1.11142 WP_000036392.1.11168 WP_000036392.1.11190 WP_000036392.1.11213 WP_000036392.1.11239 WP_000036392.1.11253 WP_000036392.1.11254 WP_000036392.1.11295 WP_000036392.1.11314 WP_000036392.1.1135 WP_000036392.1.11362 WP_000036392.1.11369 WP_000036392.1.1137 WP_000036392.1.11385 WP_000036392.1.1142 WP_000036392.1.11426 WP_000036392.1.11429 WP_000036392.1.11455 WP_000036392.1.11458 WP_000036392.1.11518 WP_000036392.1.11532 WP_000036392.1.11543 WP_000036392.1.11557 WP_000036392.1.11567 WP_000036392.1.11621 WP_000036392.1.11638 WP_000036392.1.11763 WP_000036392.1.11772 WP_000036392.1.11810 WP_000036392.1.11875 WP_000036392.1.11883 WP_000036392.1.11897 WP_000036392.1.11908 WP_000036392.1.11914 WP_000036392.1.11936 WP_000036392.1.11964 WP_000036392.1.12007 WP_000036392.1.12025 WP_000036392.1.12040 WP_000036392.1.12047 WP_000036392.1.12059 WP_000036392.1.12061 WP_000036392.1.12063 WP_000036392.1.1207 WP_000036392.1.12114 WP_000036392.1.12141 WP_000036392.1.12159 WP_000036392.1.12172 WP_000036392.1.12192 WP_000036392.1.12210 WP_000036392.1.1224 WP_000036392.1.12244 WP_000036392.1.12280 WP_000036392.1.12308 WP_000036392.1.12351 WP_000036392.1.12364 WP_000036392.1.12370 WP_000036392.1.12396 WP_000036392.1.12397 WP_000036392.1.12398 WP_000036392.1.12441 WP_000036392.1.12472 WP_000036392.1.12484 WP_000036392.1.1250 WP_000036392.1.12546 WP_000036392.1.12581 WP_000036392.1.12584 WP_000036392.1.12620 WP_000036392.1.1264 WP_000036392.1.12648 WP_000036392.1.12650 WP_000036392.1.12683 WP_000036392.1.12701 WP_000036392.1.12726 WP_000036392.1.12727 WP_000036392.1.12728 WP_000036392.1.12741 WP_000036392.1.12834 WP_000036392.1.12864 WP_000036392.1.12865 WP_000036392.1.12879 WP_000036392.1.12936 WP_000036392.1.12995 WP_000036392.1.13027 WP_000036392.1.13101 WP_000036392.1.13106 WP_000036392.1.13108 WP_000036392.1.13130 WP_000036392.1.13161 WP_000036392.1.1321 WP_000036392.1.13262 WP_000036392.1.13268 WP_000036392.1.13291 WP_000036392.1.133 WP_000036392.1.13314 WP_000036392.1.13334 WP_000036392.1.13338 WP_000036392.1.13342 WP_000036392.1.13352 WP_000036392.1.13406 WP_000036392.1.13414 WP_000036392.1.13429 WP_000036392.1.13440 WP_000036392.1.13443 WP_000036392.1.13476 WP_000036392.1.13488 WP_000036392.1.13509 WP_000036392.1.13543 WP_000036392.1.13599 WP_000036392.1.13602 WP_000036392.1.13669 WP_000036392.1.13677 WP_000036392.1.13686 WP_000036392.1.1372 WP_000036392.1.13732 WP_000036392.1.13741 WP_000036392.1.13750 WP_000036392.1.13764 WP_000036392.1.1382 WP_000036392.1.13829 WP_000036392.1.13848 WP_000036392.1.13857 WP_000036392.1.1387 WP_000036392.1.13908 WP_000036392.1.13932 WP_000036392.1.13967 WP_000036392.1.13968 WP_000036392.1.1397 WP_000036392.1.13972 WP_000036392.1.140 WP_000036392.1.14001 WP_000036392.1.1401 WP_000036392.1.14050 WP_000036392.1.14056 WP_000036392.1.1408 WP_000036392.1.14089 WP_000036392.1.14099 WP_000036392.1.14120 WP_000036392.1.14123 WP_000036392.1.14150 WP_000036392.1.14151 WP_000036392.1.14191 WP_000036392.1.14197 WP_000036392.1.14239 WP_000036392.1.14280 WP_000036392.1.14286 WP_000036392.1.14320 WP_000036392.1.14333 WP_000036392.1.14369 WP_000036392.1.14379 WP_000036392.1.14399 WP_000036392.1.14406 WP_000036392.1.14410 WP_000036392.1.14444 WP_000036392.1.14446 WP_000036392.1.14466 WP_000036392.1.14467 WP_000036392.1.14474 WP_000036392.1.14495 WP_000036392.1.14500 WP_000036392.1.14505 WP_000036392.1.14516 WP_000036392.1.14524 WP_000036392.1.14526 WP_000036392.1.14528 WP_000036392.1.14550 WP_000036392.1.14554 WP_000036392.1.14575 WP_000036392.1.14688 WP_000036392.1.14701 WP_000036392.1.14703 WP_000036392.1.14719 WP_000036392.1.14725 WP_000036392.1.1473 WP_000036392.1.14765 WP_000036392.1.14789 WP_000036392.1.14810 WP_000036392.1.14852 WP_000036392.1.14876 WP_000036392.1.14877 WP_000036392.1.14884 WP_000036392.1.1489 WP_000036392.1.14894 WP_000036392.1.14917 WP_000036392.1.14930 WP_000036392.1.14932 WP_000036392.1.14947 WP_000036392.1.14948 WP_000036392.1.14964 WP_000036392.1.15011 WP_000036392.1.15046 WP_000036392.1.15055 WP_000036392.1.15059 WP_000036392.1.15100 WP_000036392.1.15102 WP_000036392.1.15124 WP_000036392.1.15184 WP_000036392.1.15223 WP_000036392.1.15226 WP_000036392.1.15244 WP_000036392.1.15265 WP_000036392.1.15316 WP_000036392.1.15362 WP_000036392.1.15369 WP_000036392.1.1540 WP_000036392.1.15415 WP_000036392.1.15423 WP_000036392.1.15433 WP_000036392.1.15439 WP_000036392.1.15479 WP_000036392.1.15487 WP_000036392.1.15508 WP_000036392.1.15535 WP_000036392.1.15581 WP_000036392.1.15586 WP_000036392.1.15597 WP_000036392.1.15627 WP_000036392.1.15710 WP_000036392.1.15717 WP_000036392.1.15784 WP_000036392.1.15830 WP_000036392.1.15905 WP_000036392.1.15912 WP_000036392.1.1592 WP_000036392.1.15938 WP_000036392.1.15970 WP_000036392.1.15978 WP_000036392.1.16000 WP_000036392.1.16032 WP_000036392.1.16046 WP_000036392.1.16051 WP_000036392.1.16052 WP_000036392.1.16058 WP_000036392.1.16062 WP_000036392.1.16063 WP_000036392.1.16103 WP_000036392.1.1611 WP_000036392.1.16125 WP_000036392.1.16150 WP_000036392.1.16155 WP_000036392.1.16158 WP_000036392.1.16172 WP_000036392.1.16226 WP_000036392.1.16233 WP_000036392.1.1626 WP_000036392.1.16264 WP_000036392.1.16273 WP_000036392.1.16284 WP_000036392.1.16328 WP_000036392.1.16344 WP_000036392.1.1635 WP_000036392.1.16452 WP_000036392.1.16461 WP_000036392.1.16462 WP_000036392.1.16465 WP_000036392.1.16468 WP_000036392.1.16508 WP_000036392.1.16522 WP_000036392.1.16551 WP_000036392.1.16565 WP_000036392.1.16581 WP_000036392.1.16588 WP_000036392.1.16614 WP_000036392.1.16650 WP_000036392.1.16656 WP_000036392.1.16658 WP_000036392.1.16666 WP_000036392.1.16673 WP_000036392.1.1668 WP_000036392.1.16686 WP_000036392.1.16691 WP_000036392.1.167 WP_000036392.1.16710 WP_000036392.1.16732 WP_000036392.1.16735 WP_000036392.1.1674 WP_000036392.1.16767 WP_000036392.1.16781 WP_000036392.1.16786 WP_000036392.1.16819 WP_000036392.1.16826 WP_000036392.1.16846 WP_000036392.1.16855 WP_000036392.1.16858 WP_000036392.1.16879 WP_000036392.1.1689 WP_000036392.1.16893 WP_000036392.1.16896 WP_000036392.1.16905 WP_000036392.1.16910 WP_000036392.1.16948 WP_000036392.1.16965 WP_000036392.1.16998 WP_000036392.1.1700 WP_000036392.1.17031 WP_000036392.1.17049 WP_000036392.1.17058 WP_000036392.1.17078 WP_000036392.1.17188 WP_000036392.1.17202 WP_000036392.1.17219 WP_000036392.1.1722 WP_000036392.1.17302 WP_000036392.1.17307 WP_000036392.1.17308 WP_000036392.1.17368 WP_000036392.1.1737 WP_000036392.1.174 WP_000036392.1.17405 WP_000036392.1.17406 WP_000036392.1.17439 WP_000036392.1.17480 WP_000036392.1.1749 WP_000036392.1.17504 WP_000036392.1.17513 WP_000036392.1.17543 WP_000036392.1.17546 WP_000036392.1.17560 WP_000036392.1.17563 WP_000036392.1.1757 WP_000036392.1.17578 WP_000036392.1.17622 WP_000036392.1.17629 WP_000036392.1.17659 WP_000036392.1.17667 WP_000036392.1.17686 WP_000036392.1.17693 WP_000036392.1.17702 WP_000036392.1.17703 WP_000036392.1.17705 WP_000036392.1.17741 WP_000036392.1.17747 WP_000036392.1.17755 WP_000036392.1.17840 WP_000036392.1.17901 WP_000036392.1.17919 WP_000036392.1.17949 WP_000036392.1.17956 WP_000036392.1.18005 WP_000036392.1.1801 WP_000036392.1.18019 WP_000036392.1.18021 WP_000036392.1.18022 WP_000036392.1.18099 WP_000036392.1.18111 WP_000036392.1.18124 WP_000036392.1.18144 WP_000036392.1.18163 WP_000036392.1.18173 WP_000036392.1.18192 WP_000036392.1.1825 WP_000036392.1.18265 WP_000036392.1.18267 WP_000036392.1.18270 WP_000036392.1.18280 WP_000036392.1.18282 WP_000036392.1.18328 WP_000036392.1.18355 WP_000036392.1.18358 WP_000036392.1.18370 WP_000036392.1.18406 WP_000036392.1.18426 WP_000036392.1.18441 WP_000036392.1.18445 WP_000036392.1.18468 WP_000036392.1.18474 WP_000036392.1.18485 WP_000036392.1.18513 WP_000036392.1.18607 WP_000036392.1.18610 WP_000036392.1.18678 WP_000036392.1.18705 WP_000036392.1.18715 WP_000036392.1.18722 WP_000036392.1.18766 WP_000036392.1.18776 WP_000036392.1.1880 WP_000036392.1.18822 WP_000036392.1.1885 WP_000036392.1.18860 WP_000036392.1.18881 WP_000036392.1.18919 WP_000036392.1.18922 WP_000036392.1.18940 WP_000036392.1.18949 WP_000036392.1.18959 WP_000036392.1.19001 WP_000036392.1.19006 WP_000036392.1.19030 WP_000036392.1.19044 WP_000036392.1.19053 WP_000036392.1.19084 WP_000036392.1.19163 WP_000036392.1.19187 WP_000036392.1.19228 WP_000036392.1.19288 WP_000036392.1.19291 WP_000036392.1.19300 WP_000036392.1.19320 WP_000036392.1.19357 WP_000036392.1.19422 WP_000036392.1.19454 WP_000036392.1.19456 WP_000036392.1.19458 WP_000036392.1.19460 WP_000036392.1.19461 WP_000036392.1.19469 WP_000036392.1.19496 WP_000036392.1.19535 WP_000036392.1.19538 WP_000036392.1.19589 WP_000036392.1.19614 WP_000036392.1.19642 WP_000036392.1.19663 WP_000036392.1.1968 WP_000036392.1.19686 WP_000036392.1.19702 WP_000036392.1.19706 WP_000036392.1.19723 WP_000036392.1.19724 WP_000036392.1.19731 WP_000036392.1.19740 WP_000036392.1.19749 WP_000036392.1.19784 WP_000036392.1.19794 WP_000036392.1.19802 WP_000036392.1.19809 WP_000036392.1.19867 WP_000036392.1.19882 WP_000036392.1.1992 WP_000036392.1.19967 WP_000036392.1.1998 WP_000036392.1.19999 WP_000036392.1.20 WP_000036392.1.20023 WP_000036392.1.20081 WP_000036392.1.2010 WP_000036392.1.20119 WP_000036392.1.20212 WP_000036392.1.20218 WP_000036392.1.20254 WP_000036392.1.20255 WP_000036392.1.20266 WP_000036392.1.20271 WP_000036392.1.20296 WP_000036392.1.20330 WP_000036392.1.20339 WP_000036392.1.20362 WP_000036392.1.20415 WP_000036392.1.20418 WP_000036392.1.20419 WP_000036392.1.20443 WP_000036392.1.20465 WP_000036392.1.20488 WP_000036392.1.20492 WP_000036392.1.20503 WP_000036392.1.20525 WP_000036392.1.2053 WP_000036392.1.2054 WP_000036392.1.20553 WP_000036392.1.20564 WP_000036392.1.20626 WP_000036392.1.20631 WP_000036392.1.20635 WP_000036392.1.20646 WP_000036392.1.20700 WP_000036392.1.20718 WP_000036392.1.20721 WP_000036392.1.2073 WP_000036392.1.20740 WP_000036392.1.20795 WP_000036392.1.20828 WP_000036392.1.20862 WP_000036392.1.2087 WP_000036392.1.20883 WP_000036392.1.20886 WP_000036392.1.20900 WP_000036392.1.20908 WP_000036392.1.2091 WP_000036392.1.20947 WP_000036392.1.20953 WP_000036392.1.21010 WP_000036392.1.21049 WP_000036392.1.2106 WP_000036392.1.21062 WP_000036392.1.21075 WP_000036392.1.21089 WP_000036392.1.21144 WP_000036392.1.21146 WP_000036392.1.21162 WP_000036392.1.21184 WP_000036392.1.21185 WP_000036392.1.21245 WP_000036392.1.21246 WP_000036392.1.21269 WP_000036392.1.21286 WP_000036392.1.21309 WP_000036392.1.21326 WP_000036392.1.21366 WP_000036392.1.2139 WP_000036392.1.21399 WP_000036392.1.21400 WP_000036392.1.21443 WP_000036392.1.2146 WP_000036392.1.21492 WP_000036392.1.21497 WP_000036392.1.21499 WP_000036392.1.21534 WP_000036392.1.21548 WP_000036392.1.21603 WP_000036392.1.2166 WP_000036392.1.21674 WP_000036392.1.21751 WP_000036392.1.21757 WP_000036392.1.21825 WP_000036392.1.21886 WP_000036392.1.21910 WP_000036392.1.21940 WP_000036392.1.21946 WP_000036392.1.21966 WP_000036392.1.21981 WP_000036392.1.22024 WP_000036392.1.2205 WP_000036392.1.22062 WP_000036392.1.22064 WP_000036392.1.22067 WP_000036392.1.22118 WP_000036392.1.22126 WP_000036392.1.2216 WP_000036392.1.22169 WP_000036392.1.22205 WP_000036392.1.22208 WP_000036392.1.2221 WP_000036392.1.22240 WP_000036392.1.2227 WP_000036392.1.22337 WP_000036392.1.2235 WP_000036392.1.22373 WP_000036392.1.22379 WP_000036392.1.22427 WP_000036392.1.22451 WP_000036392.1.2246 WP_000036392.1.22476 WP_000036392.1.22485 WP_000036392.1.22537 WP_000036392.1.22565 WP_000036392.1.22566 WP_000036392.1.22575 WP_000036392.1.22614 WP_000036392.1.22620 WP_000036392.1.22623 WP_000036392.1.22652 WP_000036392.1.22676 WP_000036392.1.22683 WP_000036392.1.2284 WP_000036392.1.22870 WP_000036392.1.22895 WP_000036392.1.22926 WP_000036392.1.22943 WP_000036392.1.22967 WP_000036392.1.22979 WP_000036392.1.23040 WP_000036392.1.23058 WP_000036392.1.23080 WP_000036392.1.23102 WP_000036392.1.23114 WP_000036392.1.2314 WP_000036392.1.23175 WP_000036392.1.23192 WP_000036392.1.23218 WP_000036392.1.23246 WP_000036392.1.23258 WP_000036392.1.23259 WP_000036392.1.23279 WP_000036392.1.2331 WP_000036392.1.23311 WP_000036392.1.2332 WP_000036392.1.23340 WP_000036392.1.23343 WP_000036392.1.2336 WP_000036392.1.23365 WP_000036392.1.23412 WP_000036392.1.2342 WP_000036392.1.23426 WP_000036392.1.23460 WP_000036392.1.23472 WP_000036392.1.23482 WP_000036392.1.23492 WP_000036392.1.23500 WP_000036392.1.23513 WP_000036392.1.23515 WP_000036392.1.23529 WP_000036392.1.23548 WP_000036392.1.23571 WP_000036392.1.23604 WP_000036392.1.23621 WP_000036392.1.23634 WP_000036392.1.23639 WP_000036392.1.2364 WP_000036392.1.23643 WP_000036392.1.23646 WP_000036392.1.23675 WP_000036392.1.23679 WP_000036392.1.23685 WP_000036392.1.237 WP_000036392.1.23720 WP_000036392.1.23728 WP_000036392.1.2375 WP_000036392.1.23755 WP_000036392.1.23783 WP_000036392.1.23786 WP_000036392.1.23787 WP_000036392.1.2380 WP_000036392.1.23801 WP_000036392.1.23819 WP_000036392.1.23932 WP_000036392.1.24017 WP_000036392.1.24028 WP_000036392.1.24061 WP_000036392.1.24083 WP_000036392.1.24117 WP_000036392.1.24125 WP_000036392.1.24138 WP_000036392.1.24153 WP_000036392.1.24206 WP_000036392.1.24291 WP_000036392.1.24308 WP_000036392.1.24322 WP_000036392.1.24355 WP_000036392.1.24375 WP_000036392.1.24376 WP_000036392.1.24394 WP_000036392.1.24400 WP_000036392.1.24419 WP_000036392.1.24420 WP_000036392.1.24578 WP_000036392.1.24619 WP_000036392.1.24643 WP_000036392.1.2467 WP_000036392.1.24686 WP_000036392.1.24688 WP_000036392.1.24689 WP_000036392.1.24696 WP_000036392.1.24716 WP_000036392.1.24737 WP_000036392.1.24779 WP_000036392.1.2481 WP_000036392.1.24832 WP_000036392.1.24837 WP_000036392.1.24839 WP_000036392.1.24964 WP_000036392.1.24995 WP_000036392.1.25008 WP_000036392.1.25015 WP_000036392.1.25017 WP_000036392.1.25032 WP_000036392.1.25036 WP_000036392.1.25041 WP_000036392.1.25053 WP_000036392.1.25064 WP_000036392.1.25130 WP_000036392.1.25140 WP_000036392.1.25185 WP_000036392.1.25196 WP_000036392.1.25205 WP_000036392.1.25206 WP_000036392.1.25210 WP_000036392.1.25219 WP_000036392.1.25304 WP_000036392.1.25374 WP_000036392.1.25405 WP_000036392.1.25454 WP_000036392.1.25475 WP_000036392.1.25490 WP_000036392.1.25493 WP_000036392.1.25508 WP_000036392.1.25512 WP_000036392.1.25514 WP_000036392.1.25546 WP_000036392.1.25603 WP_000036392.1.2562 WP_000036392.1.25666 WP_000036392.1.25668 WP_000036392.1.25690 WP_000036392.1.2570 WP_000036392.1.25700 WP_000036392.1.25703 WP_000036392.1.25740 WP_000036392.1.25793 WP_000036392.1.25807 WP_000036392.1.25809 WP_000036392.1.25814 WP_000036392.1.25821 WP_000036392.1.25825 WP_000036392.1.25833 WP_000036392.1.25835 WP_000036392.1.25846 WP_000036392.1.25882 WP_000036392.1.25911 WP_000036392.1.25928 WP_000036392.1.25932 WP_000036392.1.25962 WP_000036392.1.25963 WP_000036392.1.25988 WP_000036392.1.26001 WP_000036392.1.26027 WP_000036392.1.26030 WP_000036392.1.26107 WP_000036392.1.26122 WP_000036392.1.2615 WP_000036392.1.26217 WP_000036392.1.26230 WP_000036392.1.26232 WP_000036392.1.26272 WP_000036392.1.26282 WP_000036392.1.26286 WP_000036392.1.26288 WP_000036392.1.26311 WP_000036392.1.26319 WP_000036392.1.2634 WP_000036392.1.26384 WP_000036392.1.26394 WP_000036392.1.26429 WP_000036392.1.26440 WP_000036392.1.26491 WP_000036392.1.26493 WP_000036392.1.26512 WP_000036392.1.2654 WP_000036392.1.26551 WP_000036392.1.26554 WP_000036392.1.26567 WP_000036392.1.2660 WP_000036392.1.26636 WP_000036392.1.26689 WP_000036392.1.26750 WP_000036392.1.2679 WP_000036392.1.26856 WP_000036392.1.26882 WP_000036392.1.26883 WP_000036392.1.26892 WP_000036392.1.26908 WP_000036392.1.2692 WP_000036392.1.26924 WP_000036392.1.26928 WP_000036392.1.26980 WP_000036392.1.270 WP_000036392.1.27008 WP_000036392.1.27010 WP_000036392.1.27027 WP_000036392.1.27051 WP_000036392.1.27070 WP_000036392.1.27072 WP_000036392.1.27077 WP_000036392.1.27086 WP_000036392.1.27087 WP_000036392.1.27111 WP_000036392.1.27115 WP_000036392.1.2713 WP_000036392.1.2717 WP_000036392.1.27173 WP_000036392.1.272 WP_000036392.1.27206 WP_000036392.1.27228 WP_000036392.1.2723 WP_000036392.1.27255 WP_000036392.1.27282 WP_000036392.1.27285 WP_000036392.1.27309 WP_000036392.1.27329 WP_000036392.1.27361 WP_000036392.1.27423 WP_000036392.1.27452 WP_000036392.1.27523 WP_000036392.1.27535 WP_000036392.1.27556 WP_000036392.1.27561 WP_000036392.1.27565 WP_000036392.1.27595 WP_000036392.1.27598 WP_000036392.1.2763 WP_000036392.1.27665 WP_000036392.1.27679 WP_000036392.1.27706 WP_000036392.1.27707 WP_000036392.1.27713 WP_000036392.1.27755 WP_000036392.1.27761 WP_000036392.1.2777 WP_000036392.1.27775 WP_000036392.1.27776 WP_000036392.1.27785 WP_000036392.1.27798 WP_000036392.1.27857 WP_000036392.1.27900 WP_000036392.1.27928 WP_000036392.1.27945 WP_000036392.1.27977 WP_000036392.1.28002 WP_000036392.1.28004 WP_000036392.1.28073 WP_000036392.1.2809 WP_000036392.1.28094 WP_000036392.1.28126 WP_000036392.1.28155 WP_000036392.1.28170 WP_000036392.1.28198 WP_000036392.1.2822 WP_000036392.1.28225 WP_000036392.1.28229 WP_000036392.1.28267 WP_000036392.1.28301 WP_000036392.1.28302 WP_000036392.1.2835 WP_000036392.1.28370 WP_000036392.1.28384 WP_000036392.1.28386 WP_000036392.1.28393 WP_000036392.1.28395 WP_000036392.1.284 WP_000036392.1.2845 WP_000036392.1.28479 WP_000036392.1.28504 WP_000036392.1.28538 WP_000036392.1.28575 WP_000036392.1.28625 WP_000036392.1.28627 WP_000036392.1.28655 WP_000036392.1.28673 WP_000036392.1.28692 WP_000036392.1.28694 WP_000036392.1.287 WP_000036392.1.2873 WP_000036392.1.28775 WP_000036392.1.2879 WP_000036392.1.28811 WP_000036392.1.2890 WP_000036392.1.28902 WP_000036392.1.28917 WP_000036392.1.28938 WP_000036392.1.28946 WP_000036392.1.28948 WP_000036392.1.28962 WP_000036392.1.28977 WP_000036392.1.29006 WP_000036392.1.29010 WP_000036392.1.29023 WP_000036392.1.29042 WP_000036392.1.2905 WP_000036392.1.2907 WP_000036392.1.29081 WP_000036392.1.29089 WP_000036392.1.29099 WP_000036392.1.2910 WP_000036392.1.29153 WP_000036392.1.29174 WP_000036392.1.29203 WP_000036392.1.29237 WP_000036392.1.29248 WP_000036392.1.29255 WP_000036392.1.29288 WP_000036392.1.29349 WP_000036392.1.29389 WP_000036392.1.29439 WP_000036392.1.2946 WP_000036392.1.29462 WP_000036392.1.29530 WP_000036392.1.29563 WP_000036392.1.29588 WP_000036392.1.29601 WP_000036392.1.29606 WP_000036392.1.29615 WP_000036392.1.29619 WP_000036392.1.29682 WP_000036392.1.29704 WP_000036392.1.29727 WP_000036392.1.29732 WP_000036392.1.29743 WP_000036392.1.29768 WP_000036392.1.29782 WP_000036392.1.29833 WP_000036392.1.29851 WP_000036392.1.29865 WP_000036392.1.29886 WP_000036392.1.29919 WP_000036392.1.2994 WP_000036392.1.29964 WP_000036392.1.29969 WP_000036392.1.29983 WP_000036392.1.30006 WP_000036392.1.30009 WP_000036392.1.30013 WP_000036392.1.3002 WP_000036392.1.30027 WP_000036392.1.30034 WP_000036392.1.30049 WP_000036392.1.30058 WP_000036392.1.3017 WP_000036392.1.30170 WP_000036392.1.30172 WP_000036392.1.30180 WP_000036392.1.30185 WP_000036392.1.30331 WP_000036392.1.30354 WP_000036392.1.30357 WP_000036392.1.30362 WP_000036392.1.30386 WP_000036392.1.3042 WP_000036392.1.30421 WP_000036392.1.30425 WP_000036392.1.30440 WP_000036392.1.30448 WP_000036392.1.30469 WP_000036392.1.30489 WP_000036392.1.30505 WP_000036392.1.30507 WP_000036392.1.30517 WP_000036392.1.30535 WP_000036392.1.30542 WP_000036392.1.30544 WP_000036392.1.30547 WP_000036392.1.30555 WP_000036392.1.30556 WP_000036392.1.30572 WP_000036392.1.30585 WP_000036392.1.30602 WP_000036392.1.30618 WP_000036392.1.30664 WP_000036392.1.3068 WP_000036392.1.30688 WP_000036392.1.30696 WP_000036392.1.3076 WP_000036392.1.30794 WP_000036392.1.3080 WP_000036392.1.30803 WP_000036392.1.30806 WP_000036392.1.30819 WP_000036392.1.30823 WP_000036392.1.30833 WP_000036392.1.30835 WP_000036392.1.30967 WP_000036392.1.30972 WP_000036392.1.31 WP_000036392.1.31001 WP_000036392.1.31011 WP_000036392.1.31046 WP_000036392.1.31066 WP_000036392.1.31069 WP_000036392.1.31078 WP_000036392.1.31086 WP_000036392.1.3113 WP_000036392.1.31139 WP_000036392.1.3114 WP_000036392.1.31145 WP_000036392.1.31155 WP_000036392.1.31156 WP_000036392.1.31171 WP_000036392.1.31182 WP_000036392.1.31185 WP_000036392.1.3119 WP_000036392.1.31190 WP_000036392.1.31195 WP_000036392.1.31196 WP_000036392.1.31198 WP_000036392.1.31205 WP_000036392.1.3121 WP_000036392.1.31214 WP_000036392.1.31219 WP_000036392.1.31223 WP_000036392.1.3124 WP_000036392.1.31251 WP_000036392.1.31281 WP_000036392.1.31303 WP_000036392.1.3131 WP_000036392.1.31352 WP_000036392.1.31362 WP_000036392.1.31389 WP_000036392.1.31413 WP_000036392.1.31446 WP_000036392.1.31504 WP_000036392.1.31515 WP_000036392.1.31533 WP_000036392.1.31546 WP_000036392.1.31578 WP_000036392.1.31658 WP_000036392.1.31665 WP_000036392.1.3170 WP_000036392.1.31725 WP_000036392.1.31762 WP_000036392.1.31799 WP_000036392.1.31836 WP_000036392.1.31854 WP_000036392.1.31927 WP_000036392.1.31940 WP_000036392.1.31951 WP_000036392.1.31952 WP_000036392.1.31967 WP_000036392.1.31972 WP_000036392.1.32006 WP_000036392.1.32041 WP_000036392.1.32042 WP_000036392.1.32056 WP_000036392.1.3207 WP_000036392.1.32170 WP_000036392.1.32189 WP_000036392.1.32192 WP_000036392.1.32202 WP_000036392.1.32206 WP_000036392.1.32263 WP_000036392.1.32293 WP_000036392.1.32299 WP_000036392.1.32368 WP_000036392.1.32408 WP_000036392.1.32422 WP_000036392.1.32424 WP_000036392.1.32425 WP_000036392.1.32438 WP_000036392.1.32458 WP_000036392.1.32460 WP_000036392.1.32491 WP_000036392.1.32515 WP_000036392.1.32527 WP_000036392.1.32529 WP_000036392.1.32545 WP_000036392.1.32563 WP_000036392.1.32578 WP_000036392.1.32617 WP_000036392.1.32629 WP_000036392.1.32660 WP_000036392.1.3270 WP_000036392.1.32702 WP_000036392.1.32714 WP_000036392.1.32725 WP_000036392.1.3278 WP_000036392.1.32786 WP_000036392.1.32804 WP_000036392.1.32838 WP_000036392.1.32848 WP_000036392.1.32860 WP_000036392.1.32868 WP_000036392.1.329 WP_000036392.1.3290 WP_000036392.1.32907 WP_000036392.1.32930 WP_000036392.1.32940 WP_000036392.1.32941 WP_000036392.1.3296 WP_000036392.1.32966 WP_000036392.1.32985 WP_000036392.1.33010 WP_000036392.1.33030 WP_000036392.1.33037 WP_000036392.1.3305 WP_000036392.1.33051 WP_000036392.1.33065 WP_000036392.1.33078 WP_000036392.1.33106 WP_000036392.1.33122 WP_000036392.1.33127 WP_000036392.1.33143 WP_000036392.1.3315 WP_000036392.1.33208 WP_000036392.1.33214 WP_000036392.1.33247 WP_000036392.1.33248 WP_000036392.1.33261 WP_000036392.1.33280 WP_000036392.1.33283 WP_000036392.1.333 WP_000036392.1.33313 WP_000036392.1.33339 WP_000036392.1.33382 WP_000036392.1.33420 WP_000036392.1.33486 WP_000036392.1.33490 WP_000036392.1.33492 WP_000036392.1.33501 WP_000036392.1.33504 WP_000036392.1.33529 WP_000036392.1.33553 WP_000036392.1.33592 WP_000036392.1.33659 WP_000036392.1.33689 WP_000036392.1.33693 WP_000036392.1.3370 WP_000036392.1.33730 WP_000036392.1.33741 WP_000036392.1.33840 WP_000036392.1.33894 WP_000036392.1.3392 WP_000036392.1.33926 WP_000036392.1.33957 WP_000036392.1.33969 WP_000036392.1.33986 WP_000036392.1.34001 WP_000036392.1.34043 WP_000036392.1.34059 WP_000036392.1.34075 WP_000036392.1.34081 WP_000036392.1.34084 WP_000036392.1.34107 WP_000036392.1.34118 WP_000036392.1.34211 WP_000036392.1.34214 WP_000036392.1.34234 WP_000036392.1.34257 WP_000036392.1.34279 WP_000036392.1.34284 WP_000036392.1.34304 WP_000036392.1.34319 WP_000036392.1.34376 WP_000036392.1.34382 WP_000036392.1.34424 WP_000036392.1.34453 WP_000036392.1.34458 WP_000036392.1.34484 WP_000036392.1.34517 WP_000036392.1.34530 WP_000036392.1.34610 WP_000036392.1.34659 WP_000036392.1.34665 WP_000036392.1.34667 WP_000036392.1.34694 WP_000036392.1.34703 WP_000036392.1.34707 WP_000036392.1.34751 WP_000036392.1.34801 WP_000036392.1.34808 WP_000036392.1.34824 WP_000036392.1.34834 WP_000036392.1.34854 WP_000036392.1.34856 WP_000036392.1.34881 WP_000036392.1.34932 WP_000036392.1.34962 WP_000036392.1.34972 WP_000036392.1.34975 WP_000036392.1.34977 WP_000036392.1.35001 WP_000036392.1.35040 WP_000036392.1.35045 WP_000036392.1.35074 WP_000036392.1.35129 WP_000036392.1.35175 WP_000036392.1.35184 WP_000036392.1.35240 WP_000036392.1.35274 WP_000036392.1.35331 WP_000036392.1.35404 WP_000036392.1.35408 WP_000036392.1.3541 WP_000036392.1.35425 WP_000036392.1.35429 WP_000036392.1.35446 WP_000036392.1.35460 WP_000036392.1.35463 WP_000036392.1.35494 WP_000036392.1.35503 WP_000036392.1.35507 WP_000036392.1.35509 WP_000036392.1.35532 WP_000036392.1.3556 WP_000036392.1.35560 WP_000036392.1.3557 WP_000036392.1.35590 WP_000036392.1.35628 WP_000036392.1.35648 WP_000036392.1.3570 WP_000036392.1.35712 WP_000036392.1.35713 WP_000036392.1.35736 WP_000036392.1.35791 WP_000036392.1.35795 WP_000036392.1.35835 WP_000036392.1.35868 WP_000036392.1.35870 WP_000036392.1.35916 WP_000036392.1.35938 WP_000036392.1.35940 WP_000036392.1.35966 WP_000036392.1.36000 WP_000036392.1.36003 WP_000036392.1.3601 WP_000036392.1.36034 WP_000036392.1.36036 WP_000036392.1.36057 WP_000036392.1.36069 WP_000036392.1.36172 WP_000036392.1.36229 WP_000036392.1.36286 WP_000036392.1.36291 WP_000036392.1.36298 WP_000036392.1.36308 WP_000036392.1.36323 WP_000036392.1.36343 WP_000036392.1.36460 WP_000036392.1.3649 WP_000036392.1.36495 WP_000036392.1.36512 WP_000036392.1.36526 WP_000036392.1.36567 WP_000036392.1.36579 WP_000036392.1.36586 WP_000036392.1.36609 WP_000036392.1.36617 WP_000036392.1.36618 WP_000036392.1.36643 WP_000036392.1.36663 WP_000036392.1.36690 WP_000036392.1.3670 WP_000036392.1.36701 WP_000036392.1.36705 WP_000036392.1.36725 WP_000036392.1.36779 WP_000036392.1.36798 WP_000036392.1.36802 WP_000036392.1.36821 WP_000036392.1.36839 WP_000036392.1.36853 WP_000036392.1.36875 WP_000036392.1.36885 WP_000036392.1.36918 WP_000036392.1.36931 WP_000036392.1.36950 WP_000036392.1.37013 WP_000036392.1.37014 WP_000036392.1.37021 WP_000036392.1.37073 WP_000036392.1.37111 WP_000036392.1.37112 WP_000036392.1.37133 WP_000036392.1.37147 WP_000036392.1.37176 WP_000036392.1.37199 WP_000036392.1.37200 WP_000036392.1.37256 WP_000036392.1.37258 WP_000036392.1.37267 WP_000036392.1.3728 WP_000036392.1.37293 WP_000036392.1.37303 WP_000036392.1.37370 WP_000036392.1.37376 WP_000036392.1.3744 WP_000036392.1.37478 WP_000036392.1.37498 WP_000036392.1.37504 WP_000036392.1.3751 WP_000036392.1.37513 WP_000036392.1.37521 WP_000036392.1.37584 WP_000036392.1.37590 WP_000036392.1.37593 WP_000036392.1.37600 WP_000036392.1.37613 WP_000036392.1.37618 WP_000036392.1.37659 WP_000036392.1.37662 WP_000036392.1.37666 WP_000036392.1.37675 WP_000036392.1.37687 WP_000036392.1.37691 WP_000036392.1.37761 WP_000036392.1.37775 WP_000036392.1.37777 WP_000036392.1.378 WP_000036392.1.379 WP_000036392.1.37911 WP_000036392.1.37941 WP_000036392.1.37965 WP_000036392.1.37968 WP_000036392.1.37985 WP_000036392.1.38001 WP_000036392.1.38026 WP_000036392.1.38055 WP_000036392.1.38061 WP_000036392.1.38064 WP_000036392.1.38108 WP_000036392.1.38113 WP_000036392.1.38125 WP_000036392.1.38145 WP_000036392.1.3816 WP_000036392.1.38207 WP_000036392.1.38261 WP_000036392.1.38266 WP_000036392.1.3828 WP_000036392.1.383 WP_000036392.1.38310 WP_000036392.1.38322 WP_000036392.1.3834 WP_000036392.1.38349 WP_000036392.1.38351 WP_000036392.1.3838 WP_000036392.1.38381 WP_000036392.1.38408 WP_000036392.1.38440 WP_000036392.1.38452 WP_000036392.1.3848 WP_000036392.1.38486 WP_000036392.1.38512 WP_000036392.1.38515 WP_000036392.1.38595 WP_000036392.1.3860 WP_000036392.1.38609 WP_000036392.1.38613 WP_000036392.1.38620 WP_000036392.1.38622 WP_000036392.1.38642 WP_000036392.1.38673 WP_000036392.1.3869 WP_000036392.1.38693 WP_000036392.1.38734 WP_000036392.1.38773 WP_000036392.1.38830 WP_000036392.1.38877 WP_000036392.1.38882 WP_000036392.1.3891 WP_000036392.1.38913 WP_000036392.1.38942 WP_000036392.1.38983 WP_000036392.1.38995 WP_000036392.1.38996 WP_000036392.1.39003 WP_000036392.1.39056 WP_000036392.1.3907 WP_000036392.1.39105 WP_000036392.1.39112 WP_000036392.1.39113 WP_000036392.1.39128 WP_000036392.1.39136 WP_000036392.1.3914 WP_000036392.1.39140 WP_000036392.1.39147 WP_000036392.1.39161 WP_000036392.1.39197 WP_000036392.1.39210 WP_000036392.1.39229 WP_000036392.1.39235 WP_000036392.1.39275 WP_000036392.1.3931 WP_000036392.1.39385 WP_000036392.1.39405 WP_000036392.1.39420 WP_000036392.1.39435 WP_000036392.1.39449 WP_000036392.1.39471 WP_000036392.1.39502 WP_000036392.1.39503 WP_000036392.1.39512 WP_000036392.1.39530 WP_000036392.1.39556 WP_000036392.1.39609 WP_000036392.1.39619 WP_000036392.1.39620 WP_000036392.1.39624 WP_000036392.1.39629 WP_000036392.1.39659 WP_000036392.1.39667 WP_000036392.1.39763 WP_000036392.1.39775 WP_000036392.1.39808 WP_000036392.1.39862 WP_000036392.1.39879 WP_000036392.1.39890 WP_000036392.1.39921 WP_000036392.1.39923 WP_000036392.1.39941 WP_000036392.1.39945 WP_000036392.1.39947 WP_000036392.1.39953 WP_000036392.1.40017 WP_000036392.1.40025 WP_000036392.1.40031 WP_000036392.1.40072 WP_000036392.1.40073 WP_000036392.1.40095 WP_000036392.1.40097 WP_000036392.1.401 WP_000036392.1.4011 WP_000036392.1.40160 WP_000036392.1.40167 WP_000036392.1.40208 WP_000036392.1.40224 WP_000036392.1.40229 WP_000036392.1.40240 WP_000036392.1.40254 WP_000036392.1.40257 WP_000036392.1.40258 WP_000036392.1.40259 WP_000036392.1.40279 WP_000036392.1.40292 WP_000036392.1.40305 WP_000036392.1.40311 WP_000036392.1.40361 WP_000036392.1.40374 WP_000036392.1.40380 WP_000036392.1.40395 WP_000036392.1.4042 WP_000036392.1.40465 WP_000036392.1.40467 WP_000036392.1.40496 WP_000036392.1.40517 WP_000036392.1.40528 WP_000036392.1.40688 WP_000036392.1.40698 WP_000036392.1.40710 WP_000036392.1.40722 WP_000036392.1.4075 WP_000036392.1.40750 WP_000036392.1.40763 WP_000036392.1.40771 WP_000036392.1.40788 WP_000036392.1.40854 WP_000036392.1.40877 WP_000036392.1.4089 WP_000036392.1.40910 WP_000036392.1.40924 WP_000036392.1.40932 WP_000036392.1.40935 WP_000036392.1.40946 WP_000036392.1.40979 WP_000036392.1.41004 WP_000036392.1.41017 WP_000036392.1.41048 WP_000036392.1.41050 WP_000036392.1.4106 WP_000036392.1.41070 WP_000036392.1.41074 WP_000036392.1.41075 WP_000036392.1.41086 WP_000036392.1.41091 WP_000036392.1.41097 WP_000036392.1.41132 WP_000036392.1.41176 WP_000036392.1.41226 WP_000036392.1.41251 WP_000036392.1.41258 WP_000036392.1.41265 WP_000036392.1.41279 WP_000036392.1.41299 WP_000036392.1.41305 WP_000036392.1.41308 WP_000036392.1.41310 WP_000036392.1.41321 WP_000036392.1.41333 WP_000036392.1.41335 WP_000036392.1.4136 WP_000036392.1.41415 WP_000036392.1.41440 WP_000036392.1.41459 WP_000036392.1.41498 WP_000036392.1.41516 WP_000036392.1.41519 WP_000036392.1.41524 WP_000036392.1.41554 WP_000036392.1.41572 WP_000036392.1.41591 WP_000036392.1.41593 WP_000036392.1.41628 WP_000036392.1.41631 WP_000036392.1.41658 WP_000036392.1.41659 WP_000036392.1.41662 WP_000036392.1.41708 WP_000036392.1.41716 WP_000036392.1.41746 WP_000036392.1.41761 WP_000036392.1.41824 WP_000036392.1.41825 WP_000036392.1.41836 WP_000036392.1.4184 WP_000036392.1.41859 WP_000036392.1.41862 WP_000036392.1.41877 WP_000036392.1.41882 WP_000036392.1.41894 WP_000036392.1.41904 WP_000036392.1.41919 WP_000036392.1.41929 WP_000036392.1.41931 WP_000036392.1.41938 WP_000036392.1.4194 WP_000036392.1.41979 WP_000036392.1.41985 WP_000036392.1.42069 WP_000036392.1.42081 WP_000036392.1.42090 WP_000036392.1.42098 WP_000036392.1.42104 WP_000036392.1.42109 WP_000036392.1.42111 WP_000036392.1.42187 WP_000036392.1.42200 WP_000036392.1.42219 WP_000036392.1.42244 WP_000036392.1.42257 WP_000036392.1.42261 WP_000036392.1.4229 WP_000036392.1.42320 WP_000036392.1.42328 WP_000036392.1.42342 WP_000036392.1.42349 WP_000036392.1.42364 WP_000036392.1.42371 WP_000036392.1.42372 WP_000036392.1.42379 WP_000036392.1.42391 WP_000036392.1.42399 WP_000036392.1.42404 WP_000036392.1.42422 WP_000036392.1.42433 WP_000036392.1.42453 WP_000036392.1.42491 WP_000036392.1.42539 WP_000036392.1.4257 WP_000036392.1.42603 WP_000036392.1.42650 WP_000036392.1.42655 WP_000036392.1.4267 WP_000036392.1.42701 WP_000036392.1.42707 WP_000036392.1.4276 WP_000036392.1.42794 WP_000036392.1.42805 WP_000036392.1.42815 WP_000036392.1.42859 WP_000036392.1.42861 WP_000036392.1.42864 WP_000036392.1.4288 WP_000036392.1.4289 WP_000036392.1.42957 WP_000036392.1.4298 WP_000036392.1.42981 WP_000036392.1.43008 WP_000036392.1.43016 WP_000036392.1.43018 WP_000036392.1.43019 WP_000036392.1.43041 WP_000036392.1.43065 WP_000036392.1.43068 WP_000036392.1.43069 WP_000036392.1.43128 WP_000036392.1.43141 WP_000036392.1.43157 WP_000036392.1.43160 WP_000036392.1.43161 WP_000036392.1.43190 WP_000036392.1.43198 WP_000036392.1.43244 WP_000036392.1.4326 WP_000036392.1.43272 WP_000036392.1.43276 WP_000036392.1.43290 WP_000036392.1.43292 WP_000036392.1.43299 WP_000036392.1.43307 WP_000036392.1.43312 WP_000036392.1.43334 WP_000036392.1.43351 WP_000036392.1.43437 WP_000036392.1.43438 WP_000036392.1.43441 WP_000036392.1.43476 WP_000036392.1.43513 WP_000036392.1.43520 WP_000036392.1.43522 WP_000036392.1.43613 WP_000036392.1.43633 WP_000036392.1.43637 WP_000036392.1.43651 WP_000036392.1.43668 WP_000036392.1.43676 WP_000036392.1.43710 WP_000036392.1.43722 WP_000036392.1.43801 WP_000036392.1.43812 WP_000036392.1.43828 WP_000036392.1.43839 WP_000036392.1.43864 WP_000036392.1.43873 WP_000036392.1.43878 WP_000036392.1.43886 WP_000036392.1.43888 WP_000036392.1.43919 WP_000036392.1.43974 WP_000036392.1.44005 WP_000036392.1.44043 WP_000036392.1.44049 WP_000036392.1.44099 WP_000036392.1.44101 WP_000036392.1.44121 WP_000036392.1.44144 WP_000036392.1.44160 WP_000036392.1.44180 WP_000036392.1.44196 WP_000036392.1.44248 WP_000036392.1.44250 WP_000036392.1.44262 WP_000036392.1.44268 WP_000036392.1.4427 WP_000036392.1.44291 WP_000036392.1.44296 WP_000036392.1.44310 WP_000036392.1.44343 WP_000036392.1.44351 WP_000036392.1.44359 WP_000036392.1.44360 WP_000036392.1.4440 WP_000036392.1.44416 WP_000036392.1.44431 WP_000036392.1.44437 WP_000036392.1.44453 WP_000036392.1.44479 WP_000036392.1.44546 WP_000036392.1.44606 WP_000036392.1.44607 WP_000036392.1.44636 WP_000036392.1.44640 WP_000036392.1.4467 WP_000036392.1.4468 WP_000036392.1.44687 WP_000036392.1.44747 WP_000036392.1.44762 WP_000036392.1.44815 WP_000036392.1.44828 WP_000036392.1.4485 WP_000036392.1.44877 WP_000036392.1.44879 WP_000036392.1.44887 WP_000036392.1.449 WP_000036392.1.44917 WP_000036392.1.44927 WP_000036392.1.44971 WP_000036392.1.44996 WP_000036392.1.44998 WP_000036392.1.4501 WP_000036392.1.45038 WP_000036392.1.4505 WP_000036392.1.45067 WP_000036392.1.45072 WP_000036392.1.45074 WP_000036392.1.45079 WP_000036392.1.45093 WP_000036392.1.45098 WP_000036392.1.45123 WP_000036392.1.45134 WP_000036392.1.45136 WP_000036392.1.45177 WP_000036392.1.45184 WP_000036392.1.45229 WP_000036392.1.45241 WP_000036392.1.45259 WP_000036392.1.45322 WP_000036392.1.45344 WP_000036392.1.45349 WP_000036392.1.45365 WP_000036392.1.4540 WP_000036392.1.45435 WP_000036392.1.45462 WP_000036392.1.45523 WP_000036392.1.45544 WP_000036392.1.45550 WP_000036392.1.45585 WP_000036392.1.45596 WP_000036392.1.45648 WP_000036392.1.45660 WP_000036392.1.45690 WP_000036392.1.45781 WP_000036392.1.45797 WP_000036392.1.458 WP_000036392.1.45829 WP_000036392.1.45871 WP_000036392.1.46011 WP_000036392.1.46030 WP_000036392.1.46069 WP_000036392.1.46077 WP_000036392.1.46091 WP_000036392.1.46169 WP_000036392.1.46173 WP_000036392.1.46174 WP_000036392.1.46187 WP_000036392.1.46205 WP_000036392.1.46225 WP_000036392.1.46232 WP_000036392.1.46241 WP_000036392.1.46243 WP_000036392.1.46286 WP_000036392.1.46299 WP_000036392.1.46303 WP_000036392.1.46307 WP_000036392.1.46323 WP_000036392.1.46345 WP_000036392.1.46355 WP_000036392.1.46358 WP_000036392.1.464 WP_000036392.1.46454 WP_000036392.1.46461 WP_000036392.1.46504 WP_000036392.1.46505 WP_000036392.1.46551 WP_000036392.1.46559 WP_000036392.1.46572 WP_000036392.1.46574 WP_000036392.1.46595 WP_000036392.1.46620 WP_000036392.1.46637 WP_000036392.1.46666 WP_000036392.1.46675 WP_000036392.1.46689 WP_000036392.1.46701 WP_000036392.1.46732 WP_000036392.1.46749 WP_000036392.1.46781 WP_000036392.1.46803 WP_000036392.1.46816 WP_000036392.1.46842 WP_000036392.1.4690 WP_000036392.1.46920 WP_000036392.1.46930 WP_000036392.1.46945 WP_000036392.1.47023 WP_000036392.1.47036 WP_000036392.1.47037 WP_000036392.1.47042 WP_000036392.1.47057 WP_000036392.1.47059 WP_000036392.1.47061 WP_000036392.1.47067 WP_000036392.1.47085 WP_000036392.1.47110 WP_000036392.1.47123 WP_000036392.1.47214 WP_000036392.1.47215 WP_000036392.1.47243 WP_000036392.1.47245 WP_000036392.1.47389 WP_000036392.1.47429 WP_000036392.1.47448 WP_000036392.1.47460 WP_000036392.1.4747 WP_000036392.1.47472 WP_000036392.1.47478 WP_000036392.1.47492 WP_000036392.1.47506 WP_000036392.1.47523 WP_000036392.1.47531 WP_000036392.1.47532 WP_000036392.1.47542 WP_000036392.1.47587 WP_000036392.1.47605 WP_000036392.1.47614 WP_000036392.1.47621 WP_000036392.1.47630 WP_000036392.1.47649 WP_000036392.1.47660 WP_000036392.1.4770 WP_000036392.1.4774 WP_000036392.1.47756 WP_000036392.1.47767 WP_000036392.1.47799 WP_000036392.1.4781 WP_000036392.1.47814 WP_000036392.1.47849 WP_000036392.1.47886 WP_000036392.1.47898 WP_000036392.1.48019 WP_000036392.1.48100 WP_000036392.1.48114 WP_000036392.1.48132 WP_000036392.1.48134 WP_000036392.1.48139 WP_000036392.1.48190 WP_000036392.1.48209 WP_000036392.1.48215 WP_000036392.1.48218 WP_000036392.1.48242 WP_000036392.1.48247 WP_000036392.1.48253 WP_000036392.1.48292 WP_000036392.1.483 WP_000036392.1.48324 WP_000036392.1.48367 WP_000036392.1.48377 WP_000036392.1.48426 WP_000036392.1.48430 WP_000036392.1.48436 WP_000036392.1.48510 WP_000036392.1.4853 WP_000036392.1.48570 WP_000036392.1.48586 WP_000036392.1.4859 WP_000036392.1.48591 WP_000036392.1.48610 WP_000036392.1.48631 WP_000036392.1.48651 WP_000036392.1.48663 WP_000036392.1.48690 WP_000036392.1.48734 WP_000036392.1.48751 WP_000036392.1.48756 WP_000036392.1.48768 WP_000036392.1.48778 WP_000036392.1.48788 WP_000036392.1.48841 WP_000036392.1.48849 WP_000036392.1.4885 WP_000036392.1.48855 WP_000036392.1.48894 WP_000036392.1.48918 WP_000036392.1.48919 WP_000036392.1.48931 WP_000036392.1.48955 WP_000036392.1.48963 WP_000036392.1.48973 WP_000036392.1.48985 WP_000036392.1.49004 WP_000036392.1.49012 WP_000036392.1.49084 WP_000036392.1.49106 WP_000036392.1.49117 WP_000036392.1.49121 WP_000036392.1.4914 WP_000036392.1.49140 WP_000036392.1.49153 WP_000036392.1.49155 WP_000036392.1.49166 WP_000036392.1.49175 WP_000036392.1.49204 WP_000036392.1.49214 WP_000036392.1.49239 WP_000036392.1.49256 WP_000036392.1.49262 WP_000036392.1.49290 WP_000036392.1.49309 WP_000036392.1.49340 WP_000036392.1.49355 WP_000036392.1.49366 WP_000036392.1.49429 WP_000036392.1.49430 WP_000036392.1.49434 WP_000036392.1.49450 WP_000036392.1.49472 WP_000036392.1.49490 WP_000036392.1.49494 WP_000036392.1.495 WP_000036392.1.49515 WP_000036392.1.49545 WP_000036392.1.49550 WP_000036392.1.49572 WP_000036392.1.49590 WP_000036392.1.49602 WP_000036392.1.49703 WP_000036392.1.49769 WP_000036392.1.49780 WP_000036392.1.4979 WP_000036392.1.49790 WP_000036392.1.49803 WP_000036392.1.49805 WP_000036392.1.49846 WP_000036392.1.49848 WP_000036392.1.4991 WP_000036392.1.49929 WP_000036392.1.49947 WP_000036392.1.49959 WP_000036392.1.49997 WP_000036392.1.50 WP_000036392.1.50014 WP_000036392.1.50030 WP_000036392.1.50043 WP_000036392.1.50080 WP_000036392.1.50103 WP_000036392.1.50153 WP_000036392.1.50158 WP_000036392.1.50161 WP_000036392.1.50198 WP_000036392.1.50211 WP_000036392.1.50247 WP_000036392.1.50251 WP_000036392.1.50308 WP_000036392.1.50309 WP_000036392.1.50374 WP_000036392.1.50376 WP_000036392.1.50386 WP_000036392.1.50387 WP_000036392.1.50389 WP_000036392.1.50406 WP_000036392.1.50413 WP_000036392.1.50468 WP_000036392.1.50478 WP_000036392.1.5051 WP_000036392.1.50517 WP_000036392.1.50529 WP_000036392.1.50565 WP_000036392.1.50566 WP_000036392.1.50570 WP_000036392.1.50593 WP_000036392.1.50626 WP_000036392.1.50676 WP_000036392.1.50726 WP_000036392.1.50750 WP_000036392.1.50771 WP_000036392.1.50774 WP_000036392.1.50804 WP_000036392.1.50808 WP_000036392.1.50875 WP_000036392.1.5088 WP_000036392.1.50885 WP_000036392.1.509 WP_000036392.1.50908 WP_000036392.1.50929 WP_000036392.1.50941 WP_000036392.1.50954 WP_000036392.1.50970 WP_000036392.1.51014 WP_000036392.1.51022 WP_000036392.1.51025 WP_000036392.1.51036 WP_000036392.1.51040 WP_000036392.1.51048 WP_000036392.1.51100 WP_000036392.1.51117 WP_000036392.1.51134 WP_000036392.1.5114 WP_000036392.1.51179 WP_000036392.1.51182 WP_000036392.1.51186 WP_000036392.1.51227 WP_000036392.1.5125 WP_000036392.1.5127 WP_000036392.1.51305 WP_000036392.1.51315 WP_000036392.1.51331 WP_000036392.1.51338 WP_000036392.1.5136 WP_000036392.1.51394 WP_000036392.1.51414 WP_000036392.1.51419 WP_000036392.1.51474 WP_000036392.1.51487 WP_000036392.1.51488 WP_000036392.1.51506 WP_000036392.1.51519 WP_000036392.1.51598 WP_000036392.1.51613 WP_000036392.1.51634 WP_000036392.1.51644 WP_000036392.1.51649 WP_000036392.1.51686 WP_000036392.1.51700 WP_000036392.1.51704 WP_000036392.1.51724 WP_000036392.1.51734 WP_000036392.1.51756 WP_000036392.1.51838 WP_000036392.1.5185 WP_000036392.1.51863 WP_000036392.1.51910 WP_000036392.1.51911 WP_000036392.1.51914 WP_000036392.1.51932 WP_000036392.1.51935 WP_000036392.1.51989 WP_000036392.1.52057 WP_000036392.1.52101 WP_000036392.1.52114 WP_000036392.1.52121 WP_000036392.1.52123 WP_000036392.1.52129 WP_000036392.1.52148 WP_000036392.1.52161 WP_000036392.1.52191 WP_000036392.1.52202 WP_000036392.1.52209 WP_000036392.1.52339 WP_000036392.1.52346 WP_000036392.1.52353 WP_000036392.1.52356 WP_000036392.1.52361 WP_000036392.1.52438 WP_000036392.1.52469 WP_000036392.1.52571 WP_000036392.1.526 WP_000036392.1.52647 WP_000036392.1.52653 WP_000036392.1.52656 WP_000036392.1.52742 WP_000036392.1.52743 WP_000036392.1.52744 WP_000036392.1.52773 WP_000036392.1.52795 WP_000036392.1.52807 WP_000036392.1.52857 WP_000036392.1.52887 WP_000036392.1.52898 WP_000036392.1.52915 WP_000036392.1.52924 WP_000036392.1.53092 WP_000036392.1.53141 WP_000036392.1.53151 WP_000036392.1.53154 WP_000036392.1.53158 WP_000036392.1.53159 WP_000036392.1.53190 WP_000036392.1.53203 WP_000036392.1.53210 WP_000036392.1.53233 WP_000036392.1.53307 WP_000036392.1.53315 WP_000036392.1.53316 WP_000036392.1.53321 WP_000036392.1.53368 WP_000036392.1.53375 WP_000036392.1.53406 WP_000036392.1.53436 WP_000036392.1.53450 WP_000036392.1.53466 WP_000036392.1.5349 WP_000036392.1.53529 WP_000036392.1.53540 WP_000036392.1.53543 WP_000036392.1.53555 WP_000036392.1.53559 WP_000036392.1.5356 WP_000036392.1.53571 WP_000036392.1.5358 WP_000036392.1.53692 WP_000036392.1.53723 WP_000036392.1.5374 WP_000036392.1.53750 WP_000036392.1.53757 WP_000036392.1.53800 WP_000036392.1.53812 WP_000036392.1.53814 WP_000036392.1.53815 WP_000036392.1.53839 WP_000036392.1.53892 WP_000036392.1.53898 WP_000036392.1.53902 WP_000036392.1.5392 WP_000036392.1.53935 WP_000036392.1.53958 WP_000036392.1.53981 WP_000036392.1.53984 WP_000036392.1.54033 WP_000036392.1.54075 WP_000036392.1.54132 WP_000036392.1.5415 WP_000036392.1.54170 WP_000036392.1.54175 WP_000036392.1.54196 WP_000036392.1.542 WP_000036392.1.54203 WP_000036392.1.54209 WP_000036392.1.54259 WP_000036392.1.54271 WP_000036392.1.54273 WP_000036392.1.54274 WP_000036392.1.5430 WP_000036392.1.54319 WP_000036392.1.54340 WP_000036392.1.54364 WP_000036392.1.54371 WP_000036392.1.54400 WP_000036392.1.54431 WP_000036392.1.54442 WP_000036392.1.54482 WP_000036392.1.54522 WP_000036392.1.54558 WP_000036392.1.5456 WP_000036392.1.54569 WP_000036392.1.54589 WP_000036392.1.54607 WP_000036392.1.5462 WP_000036392.1.54644 WP_000036392.1.54662 WP_000036392.1.54667 WP_000036392.1.54678 WP_000036392.1.54681 WP_000036392.1.54694 WP_000036392.1.54722 WP_000036392.1.54748 WP_000036392.1.54749 WP_000036392.1.54764 WP_000036392.1.5481 WP_000036392.1.54814 WP_000036392.1.54822 WP_000036392.1.54845 WP_000036392.1.54865 WP_000036392.1.54935 WP_000036392.1.54979 WP_000036392.1.54984 WP_000036392.1.54992 WP_000036392.1.55008 WP_000036392.1.55010 WP_000036392.1.55034 WP_000036392.1.55073 WP_000036392.1.55152 WP_000036392.1.55156 WP_000036392.1.55163 WP_000036392.1.55165 WP_000036392.1.55166 WP_000036392.1.55200 WP_000036392.1.55215 WP_000036392.1.55224 WP_000036392.1.5523 WP_000036392.1.55285 WP_000036392.1.55290 WP_000036392.1.55310 WP_000036392.1.55317 WP_000036392.1.55379 WP_000036392.1.5539 WP_000036392.1.55461 WP_000036392.1.55468 WP_000036392.1.55475 WP_000036392.1.55506 WP_000036392.1.5555 WP_000036392.1.55554 WP_000036392.1.55557 WP_000036392.1.55604 WP_000036392.1.55614 WP_000036392.1.55623 WP_000036392.1.55639 WP_000036392.1.55647 WP_000036392.1.55672 WP_000036392.1.55699 WP_000036392.1.55706 WP_000036392.1.55725 WP_000036392.1.55743 WP_000036392.1.55768 WP_000036392.1.55780 WP_000036392.1.55782 WP_000036392.1.55796 WP_000036392.1.55803 WP_000036392.1.55967 WP_000036392.1.55993 WP_000036392.1.56002 WP_000036392.1.56004 WP_000036392.1.56012 WP_000036392.1.56026 WP_000036392.1.56070 WP_000036392.1.56082 WP_000036392.1.56097 WP_000036392.1.56100 WP_000036392.1.56105 WP_000036392.1.56144 WP_000036392.1.56172 WP_000036392.1.5621 WP_000036392.1.56222 WP_000036392.1.56226 WP_000036392.1.56238 WP_000036392.1.56261 WP_000036392.1.56286 WP_000036392.1.56303 WP_000036392.1.56304 WP_000036392.1.56311 WP_000036392.1.56354 WP_000036392.1.56370 WP_000036392.1.56374 WP_000036392.1.56385 WP_000036392.1.56414 WP_000036392.1.56419 WP_000036392.1.56423 WP_000036392.1.56438 WP_000036392.1.56468 WP_000036392.1.56514 WP_000036392.1.56535 WP_000036392.1.56560 WP_000036392.1.56585 WP_000036392.1.56597 WP_000036392.1.56601 WP_000036392.1.56614 WP_000036392.1.56615 WP_000036392.1.56640 WP_000036392.1.56647 WP_000036392.1.56651 WP_000036392.1.56671 WP_000036392.1.56682 WP_000036392.1.56724 WP_000036392.1.56791 WP_000036392.1.56825 WP_000036392.1.56853 WP_000036392.1.56875 WP_000036392.1.56877 WP_000036392.1.56887 WP_000036392.1.56889 WP_000036392.1.56893 WP_000036392.1.56942 WP_000036392.1.56981 WP_000036392.1.57000 WP_000036392.1.57076 WP_000036392.1.57084 WP_000036392.1.57101 WP_000036392.1.57125 WP_000036392.1.57137 WP_000036392.1.57147 WP_000036392.1.57168 WP_000036392.1.57179 WP_000036392.1.57186 WP_000036392.1.57187 WP_000036392.1.57232 WP_000036392.1.57233 WP_000036392.1.57244 WP_000036392.1.57307 WP_000036392.1.57342 WP_000036392.1.57344 WP_000036392.1.57377 WP_000036392.1.57399 WP_000036392.1.57418 WP_000036392.1.57433 WP_000036392.1.57494 WP_000036392.1.57510 WP_000036392.1.57515 WP_000036392.1.57521 WP_000036392.1.57529 WP_000036392.1.5753 WP_000036392.1.57534 WP_000036392.1.57576 WP_000036392.1.57601 WP_000036392.1.57607 WP_000036392.1.5761 WP_000036392.1.57684 WP_000036392.1.57699 WP_000036392.1.57709 WP_000036392.1.57763 WP_000036392.1.57781 WP_000036392.1.57785 WP_000036392.1.57800 WP_000036392.1.5781 WP_000036392.1.57862 WP_000036392.1.57873 WP_000036392.1.57890 WP_000036392.1.57891 WP_000036392.1.57965 WP_000036392.1.57972 WP_000036392.1.57978 WP_000036392.1.58008 WP_000036392.1.5801 WP_000036392.1.58040 WP_000036392.1.58041 WP_000036392.1.58044 WP_000036392.1.58081 WP_000036392.1.5809 WP_000036392.1.58131 WP_000036392.1.58132 WP_000036392.1.58153 WP_000036392.1.58173 WP_000036392.1.58191 WP_000036392.1.58194 WP_000036392.1.58239 WP_000036392.1.58252 WP_000036392.1.58261 WP_000036392.1.58274 WP_000036392.1.58282 WP_000036392.1.58324 WP_000036392.1.58326 WP_000036392.1.58357 WP_000036392.1.5836 WP_000036392.1.58372 WP_000036392.1.58416 WP_000036392.1.58418 WP_000036392.1.58442 WP_000036392.1.58451 WP_000036392.1.5846 WP_000036392.1.58467 WP_000036392.1.58485 WP_000036392.1.58537 WP_000036392.1.5854 WP_000036392.1.58548 WP_000036392.1.58564 WP_000036392.1.58568 WP_000036392.1.5858 WP_000036392.1.58583 WP_000036392.1.58652 WP_000036392.1.58662 WP_000036392.1.58663 WP_000036392.1.58669 WP_000036392.1.58724 WP_000036392.1.58729 WP_000036392.1.58745 WP_000036392.1.5875 WP_000036392.1.58796 WP_000036392.1.58803 WP_000036392.1.58807 WP_000036392.1.58834 WP_000036392.1.58836 WP_000036392.1.58847 WP_000036392.1.5886 WP_000036392.1.58883 WP_000036392.1.58898 WP_000036392.1.58949 WP_000036392.1.58963 WP_000036392.1.58970 WP_000036392.1.58974 WP_000036392.1.59006 WP_000036392.1.59020 WP_000036392.1.59043 WP_000036392.1.59056 WP_000036392.1.59061 WP_000036392.1.59064 WP_000036392.1.59068 WP_000036392.1.59094 WP_000036392.1.59136 WP_000036392.1.59224 WP_000036392.1.59236 WP_000036392.1.59276 WP_000036392.1.59282 WP_000036392.1.5929 WP_000036392.1.59299 WP_000036392.1.59313 WP_000036392.1.59336 WP_000036392.1.59375 WP_000036392.1.59381 WP_000036392.1.59412 WP_000036392.1.59439 WP_000036392.1.59458 WP_000036392.1.5949 WP_000036392.1.59490 WP_000036392.1.59501 WP_000036392.1.59508 WP_000036392.1.59510 WP_000036392.1.59521 WP_000036392.1.5953 WP_000036392.1.59636 WP_000036392.1.59641 WP_000036392.1.59684 WP_000036392.1.5969 WP_000036392.1.59694 WP_000036392.1.59710 WP_000036392.1.59751 WP_000036392.1.59771 WP_000036392.1.5979 WP_000036392.1.59827 WP_000036392.1.59829 WP_000036392.1.59830 WP_000036392.1.59847 WP_000036392.1.59863 WP_000036392.1.59953 WP_000036392.1.59969 WP_000036392.1.59979 WP_000036392.1.59994 WP_000036392.1.60008 WP_000036392.1.60021 WP_000036392.1.60045 WP_000036392.1.60069 WP_000036392.1.60076 WP_000036392.1.60114 WP_000036392.1.60140 WP_000036392.1.60154 WP_000036392.1.60155 WP_000036392.1.60168 WP_000036392.1.60192 WP_000036392.1.60199 WP_000036392.1.60209 WP_000036392.1.60212 WP_000036392.1.60213 WP_000036392.1.60226 WP_000036392.1.60231 WP_000036392.1.60253 WP_000036392.1.60285 WP_000036392.1.60322 WP_000036392.1.60324 WP_000036392.1.60330 WP_000036392.1.60356 WP_000036392.1.60379 WP_000036392.1.6038 WP_000036392.1.60380 WP_000036392.1.6041 WP_000036392.1.60424 WP_000036392.1.60464 WP_000036392.1.60481 WP_000036392.1.605 WP_000036392.1.60503 WP_000036392.1.60507 WP_000036392.1.6052 WP_000036392.1.6058 WP_000036392.1.60584 WP_000036392.1.6060 WP_000036392.1.60622 WP_000036392.1.60676 WP_000036392.1.60708 WP_000036392.1.60725 WP_000036392.1.60760 WP_000036392.1.60783 WP_000036392.1.60792 WP_000036392.1.60794 WP_000036392.1.60807 WP_000036392.1.60809 WP_000036392.1.6086 WP_000036392.1.60863 WP_000036392.1.60874 WP_000036392.1.60882 WP_000036392.1.60889 WP_000036392.1.60919 WP_000036392.1.60926 WP_000036392.1.60941 WP_000036392.1.60950 WP_000036392.1.60976 WP_000036392.1.60990 WP_000036392.1.6104 WP_000036392.1.61044 WP_000036392.1.61045 WP_000036392.1.61076 WP_000036392.1.61078 WP_000036392.1.61087 WP_000036392.1.61114 WP_000036392.1.61123 WP_000036392.1.6114 WP_000036392.1.61147 WP_000036392.1.61168 WP_000036392.1.61184 WP_000036392.1.61210 WP_000036392.1.61232 WP_000036392.1.6129 WP_000036392.1.61296 WP_000036392.1.61309 WP_000036392.1.61345 WP_000036392.1.61357 WP_000036392.1.61417 WP_000036392.1.6143 WP_000036392.1.61511 WP_000036392.1.61539 WP_000036392.1.61542 WP_000036392.1.61553 WP_000036392.1.61574 WP_000036392.1.61582 WP_000036392.1.61609 WP_000036392.1.6164 WP_000036392.1.61649 WP_000036392.1.61652 WP_000036392.1.61662 WP_000036392.1.61694 WP_000036392.1.61697 WP_000036392.1.61712 WP_000036392.1.61714 WP_000036392.1.61730 WP_000036392.1.61732 WP_000036392.1.61743 WP_000036392.1.61809 WP_000036392.1.61857 WP_000036392.1.61877 WP_000036392.1.61918 WP_000036392.1.61920 WP_000036392.1.61922 WP_000036392.1.61952 WP_000036392.1.61968 WP_000036392.1.62007 WP_000036392.1.62025 WP_000036392.1.62063 WP_000036392.1.62120 WP_000036392.1.62122 WP_000036392.1.62124 WP_000036392.1.62144 WP_000036392.1.62195 WP_000036392.1.62199 WP_000036392.1.62204 WP_000036392.1.62219 WP_000036392.1.62223 WP_000036392.1.62241 WP_000036392.1.62271 WP_000036392.1.62302 WP_000036392.1.62304 WP_000036392.1.62314 WP_000036392.1.62323 WP_000036392.1.62333 WP_000036392.1.62338 WP_000036392.1.62339 WP_000036392.1.62344 WP_000036392.1.62364 WP_000036392.1.62374 WP_000036392.1.62380 WP_000036392.1.62403 WP_000036392.1.62411 WP_000036392.1.62436 WP_000036392.1.62475 WP_000036392.1.62522 WP_000036392.1.6253 WP_000036392.1.62536 WP_000036392.1.62570 WP_000036392.1.62640 WP_000036392.1.62677 WP_000036392.1.62686 WP_000036392.1.62693 WP_000036392.1.62725 WP_000036392.1.62751 WP_000036392.1.62798 WP_000036392.1.62825 WP_000036392.1.62853 WP_000036392.1.62903 WP_000036392.1.62910 WP_000036392.1.62913 WP_000036392.1.62932 WP_000036392.1.62955 WP_000036392.1.62960 WP_000036392.1.62976 WP_000036392.1.63016 WP_000036392.1.63025 WP_000036392.1.63063 WP_000036392.1.63069 WP_000036392.1.63087 WP_000036392.1.63118 WP_000036392.1.63129 WP_000036392.1.63135 WP_000036392.1.63169 WP_000036392.1.63181 WP_000036392.1.63186 WP_000036392.1.63203 WP_000036392.1.63243 WP_000036392.1.63250 WP_000036392.1.63256 WP_000036392.1.63290 WP_000036392.1.63297 WP_000036392.1.63382 WP_000036392.1.63448 WP_000036392.1.63455 WP_000036392.1.63461 WP_000036392.1.63479 WP_000036392.1.63499 WP_000036392.1.63514 WP_000036392.1.63525 WP_000036392.1.63532 WP_000036392.1.6357 WP_000036392.1.63577 WP_000036392.1.63583 WP_000036392.1.63592 WP_000036392.1.63663 WP_000036392.1.63664 WP_000036392.1.6367 WP_000036392.1.63690 WP_000036392.1.63718 WP_000036392.1.63736 WP_000036392.1.6375 WP_000036392.1.63757 WP_000036392.1.63816 WP_000036392.1.63834 WP_000036392.1.63860 WP_000036392.1.63864 WP_000036392.1.63866 WP_000036392.1.63876 WP_000036392.1.6389 WP_000036392.1.63901 WP_000036392.1.63903 WP_000036392.1.63912 WP_000036392.1.63934 WP_000036392.1.63955 WP_000036392.1.63958 WP_000036392.1.63963 WP_000036392.1.63977 WP_000036392.1.6399 WP_000036392.1.64007 WP_000036392.1.64032 WP_000036392.1.64034 WP_000036392.1.64046 WP_000036392.1.64087 WP_000036392.1.6415 WP_000036392.1.64208 WP_000036392.1.6423 WP_000036392.1.64244 WP_000036392.1.64293 WP_000036392.1.64332 WP_000036392.1.64374 WP_000036392.1.64376 WP_000036392.1.644 WP_000036392.1.64403 WP_000036392.1.64471 WP_000036392.1.64501 WP_000036392.1.6451 WP_000036392.1.64538 WP_000036392.1.64632 WP_000036392.1.64648 WP_000036392.1.64649 WP_000036392.1.64654 WP_000036392.1.64662 WP_000036392.1.64663 WP_000036392.1.64690 WP_000036392.1.64702 WP_000036392.1.64709 WP_000036392.1.64710 WP_000036392.1.64744 WP_000036392.1.64757 WP_000036392.1.64758 WP_000036392.1.64763 WP_000036392.1.64781 WP_000036392.1.64798 WP_000036392.1.64817 WP_000036392.1.64831 WP_000036392.1.64847 WP_000036392.1.6487 WP_000036392.1.6489 WP_000036392.1.64891 WP_000036392.1.64974 WP_000036392.1.65018 WP_000036392.1.65022 WP_000036392.1.65027 WP_000036392.1.65028 WP_000036392.1.65054 WP_000036392.1.65075 WP_000036392.1.6514 WP_000036392.1.65168 WP_000036392.1.65171 WP_000036392.1.65172 WP_000036392.1.65185 WP_000036392.1.65191 WP_000036392.1.65200 WP_000036392.1.65211 WP_000036392.1.65218 WP_000036392.1.65226 WP_000036392.1.65238 WP_000036392.1.65248 WP_000036392.1.65249 WP_000036392.1.65266 WP_000036392.1.65348 WP_000036392.1.6535 WP_000036392.1.65395 WP_000036392.1.65437 WP_000036392.1.65459 WP_000036392.1.65463 WP_000036392.1.65474 WP_000036392.1.65475 WP_000036392.1.65487 WP_000036392.1.6549 WP_000036392.1.65499 WP_000036392.1.6554 WP_000036392.1.65558 WP_000036392.1.65572 WP_000036392.1.6560 WP_000036392.1.6561 WP_000036392.1.65633 WP_000036392.1.6565 WP_000036392.1.65650 WP_000036392.1.65696 WP_000036392.1.65697 WP_000036392.1.65699 WP_000036392.1.65737 WP_000036392.1.6575 WP_000036392.1.65755 WP_000036392.1.65782 WP_000036392.1.65812 WP_000036392.1.65818 WP_000036392.1.65846 WP_000036392.1.65849 WP_000036392.1.65863 WP_000036392.1.65876 WP_000036392.1.65945 WP_000036392.1.65968 WP_000036392.1.65985 WP_000036392.1.66021 WP_000036392.1.66031 WP_000036392.1.66052 WP_000036392.1.66064 WP_000036392.1.66074 WP_000036392.1.66109 WP_000036392.1.66129 WP_000036392.1.66145 WP_000036392.1.66183 WP_000036392.1.6620 WP_000036392.1.66216 WP_000036392.1.66234 WP_000036392.1.66273 WP_000036392.1.6630 WP_000036392.1.66314 WP_000036392.1.66324 WP_000036392.1.6634 WP_000036392.1.66358 WP_000036392.1.66361 WP_000036392.1.66362 WP_000036392.1.66365 WP_000036392.1.66368 WP_000036392.1.6638 WP_000036392.1.6640 WP_000036392.1.66462 WP_000036392.1.6647 WP_000036392.1.66480 WP_000036392.1.66492 WP_000036392.1.66506 WP_000036392.1.66630 WP_000036392.1.66665 WP_000036392.1.66681 WP_000036392.1.66684 WP_000036392.1.66698 WP_000036392.1.66755 WP_000036392.1.66759 WP_000036392.1.66779 WP_000036392.1.6680 WP_000036392.1.66801 WP_000036392.1.66825 WP_000036392.1.66834 WP_000036392.1.66860 WP_000036392.1.66901 WP_000036392.1.66953 WP_000036392.1.66955 WP_000036392.1.66962 WP_000036392.1.66981 WP_000036392.1.67 WP_000036392.1.67024 WP_000036392.1.67037 WP_000036392.1.67042 WP_000036392.1.67045 WP_000036392.1.67101 WP_000036392.1.67143 WP_000036392.1.67181 WP_000036392.1.67201 WP_000036392.1.67211 WP_000036392.1.67228 WP_000036392.1.67237 WP_000036392.1.67268 WP_000036392.1.67288 WP_000036392.1.67336 WP_000036392.1.67339 WP_000036392.1.67347 WP_000036392.1.67387 WP_000036392.1.67394 WP_000036392.1.67397 WP_000036392.1.67403 WP_000036392.1.67424 WP_000036392.1.67430 WP_000036392.1.67442 WP_000036392.1.67539 WP_000036392.1.67552 WP_000036392.1.67556 WP_000036392.1.67576 WP_000036392.1.67604 WP_000036392.1.67617 WP_000036392.1.67619 WP_000036392.1.67625 WP_000036392.1.67627 WP_000036392.1.67633 WP_000036392.1.67641 WP_000036392.1.67657 WP_000036392.1.67673 WP_000036392.1.67682 WP_000036392.1.67700 WP_000036392.1.67707 WP_000036392.1.67718 WP_000036392.1.67729 WP_000036392.1.67772 WP_000036392.1.67774 WP_000036392.1.67776 WP_000036392.1.67803 WP_000036392.1.67814 WP_000036392.1.67820 WP_000036392.1.67825 WP_000036392.1.67827 WP_000036392.1.67829 WP_000036392.1.6785 WP_000036392.1.67887 WP_000036392.1.67905 WP_000036392.1.67910 WP_000036392.1.67954 WP_000036392.1.67969 WP_000036392.1.68 WP_000036392.1.68036 WP_000036392.1.68043 WP_000036392.1.68073 WP_000036392.1.6809 WP_000036392.1.68105 WP_000036392.1.68113 WP_000036392.1.68115 WP_000036392.1.68131 WP_000036392.1.68182 WP_000036392.1.6819 WP_000036392.1.68201 WP_000036392.1.68206 WP_000036392.1.6827 WP_000036392.1.68275 WP_000036392.1.68285 WP_000036392.1.6833 WP_000036392.1.68359 WP_000036392.1.68420 WP_000036392.1.6849 WP_000036392.1.685 WP_000036392.1.68514 WP_000036392.1.68532 WP_000036392.1.68547 WP_000036392.1.68564 WP_000036392.1.68589 WP_000036392.1.68591 WP_000036392.1.68655 WP_000036392.1.68656 WP_000036392.1.68688 WP_000036392.1.68742 WP_000036392.1.68770 WP_000036392.1.68778 WP_000036392.1.68787 WP_000036392.1.68809 WP_000036392.1.68816 WP_000036392.1.68894 WP_000036392.1.68914 WP_000036392.1.68928 WP_000036392.1.68975 WP_000036392.1.69006 WP_000036392.1.69011 WP_000036392.1.69053 WP_000036392.1.6913 WP_000036392.1.69146 WP_000036392.1.69170 WP_000036392.1.69210 WP_000036392.1.69255 WP_000036392.1.69270 WP_000036392.1.69282 WP_000036392.1.69296 WP_000036392.1.69320 WP_000036392.1.69376 WP_000036392.1.69396 WP_000036392.1.69397 WP_000036392.1.69433 WP_000036392.1.69466 WP_000036392.1.69554 WP_000036392.1.69564 WP_000036392.1.69588 WP_000036392.1.69597 WP_000036392.1.69611 WP_000036392.1.69636 WP_000036392.1.69642 WP_000036392.1.69644 WP_000036392.1.69656 WP_000036392.1.69657 WP_000036392.1.69690 WP_000036392.1.69696 WP_000036392.1.69704 WP_000036392.1.69710 WP_000036392.1.69760 WP_000036392.1.69790 WP_000036392.1.69807 WP_000036392.1.69808 WP_000036392.1.69839 WP_000036392.1.69848 WP_000036392.1.69923 WP_000036392.1.69948 WP_000036392.1.69953 WP_000036392.1.69975 WP_000036392.1.70003 WP_000036392.1.70010 WP_000036392.1.70047 WP_000036392.1.70049 WP_000036392.1.70058 WP_000036392.1.70061 WP_000036392.1.7016 WP_000036392.1.70169 WP_000036392.1.70205 WP_000036392.1.7021 WP_000036392.1.70240 WP_000036392.1.70241 WP_000036392.1.70249 WP_000036392.1.70261 WP_000036392.1.70269 WP_000036392.1.70289 WP_000036392.1.70314 WP_000036392.1.70321 WP_000036392.1.70327 WP_000036392.1.7033 WP_000036392.1.70427 WP_000036392.1.70433 WP_000036392.1.70447 WP_000036392.1.70485 WP_000036392.1.70491 WP_000036392.1.70545 WP_000036392.1.7060 WP_000036392.1.70623 WP_000036392.1.70643 WP_000036392.1.70662 WP_000036392.1.70671 WP_000036392.1.70679 WP_000036392.1.70683 WP_000036392.1.70708 WP_000036392.1.70717 WP_000036392.1.70731 WP_000036392.1.70733 WP_000036392.1.70761 WP_000036392.1.70772 WP_000036392.1.70792 WP_000036392.1.70797 WP_000036392.1.70845 WP_000036392.1.70846 WP_000036392.1.70869 WP_000036392.1.70883 WP_000036392.1.70899 WP_000036392.1.70922 WP_000036392.1.70948 WP_000036392.1.70971 WP_000036392.1.70981 WP_000036392.1.70995 WP_000036392.1.71007 WP_000036392.1.71010 WP_000036392.1.71039 WP_000036392.1.71057 WP_000036392.1.71069 WP_000036392.1.71081 WP_000036392.1.71116 WP_000036392.1.71117 WP_000036392.1.71120 WP_000036392.1.71146 WP_000036392.1.71165 WP_000036392.1.71186 WP_000036392.1.71188 WP_000036392.1.71202 WP_000036392.1.71243 WP_000036392.1.71268 WP_000036392.1.71306 WP_000036392.1.71337 WP_000036392.1.71368 WP_000036392.1.71378 WP_000036392.1.714 WP_000036392.1.71401 WP_000036392.1.7142 WP_000036392.1.71446 WP_000036392.1.71452 WP_000036392.1.71455 WP_000036392.1.71456 WP_000036392.1.71487 WP_000036392.1.71523 WP_000036392.1.71542 WP_000036392.1.71566 WP_000036392.1.71640 WP_000036392.1.71651 WP_000036392.1.71653 WP_000036392.1.71656 WP_000036392.1.71691 WP_000036392.1.71702 WP_000036392.1.71716 WP_000036392.1.7174 WP_000036392.1.71746 WP_000036392.1.71750 WP_000036392.1.71756 WP_000036392.1.71845 WP_000036392.1.71848 WP_000036392.1.71872 WP_000036392.1.71881 WP_000036392.1.71908 WP_000036392.1.71923 WP_000036392.1.71929 WP_000036392.1.71941 WP_000036392.1.71950 WP_000036392.1.71952 WP_000036392.1.71954 WP_000036392.1.71973 WP_000036392.1.71985 WP_000036392.1.72003 WP_000036392.1.72073 WP_000036392.1.72105 WP_000036392.1.72121 WP_000036392.1.72203 WP_000036392.1.72226 WP_000036392.1.72243 WP_000036392.1.72254 WP_000036392.1.72269 WP_000036392.1.72281 WP_000036392.1.72283 WP_000036392.1.72307 WP_000036392.1.72350 WP_000036392.1.72372 WP_000036392.1.72376 WP_000036392.1.72383 WP_000036392.1.72412 WP_000036392.1.7243 WP_000036392.1.72461 WP_000036392.1.72527 WP_000036392.1.7255 WP_000036392.1.72594 WP_000036392.1.72631 WP_000036392.1.72638 WP_000036392.1.72642 WP_000036392.1.72667 WP_000036392.1.72674 WP_000036392.1.72724 WP_000036392.1.72789 WP_000036392.1.72793 WP_000036392.1.72797 WP_000036392.1.72828 WP_000036392.1.72843 WP_000036392.1.72850 WP_000036392.1.72871 WP_000036392.1.72872 WP_000036392.1.72896 WP_000036392.1.72944 WP_000036392.1.72946 WP_000036392.1.72969 WP_000036392.1.72975 WP_000036392.1.72987 WP_000036392.1.73052 WP_000036392.1.73062 WP_000036392.1.73102 WP_000036392.1.7311 WP_000036392.1.73114 WP_000036392.1.7315 WP_000036392.1.73177 WP_000036392.1.73180 WP_000036392.1.73200 WP_000036392.1.73258 WP_000036392.1.73285 WP_000036392.1.7332 WP_000036392.1.73328 WP_000036392.1.7333 WP_000036392.1.7334 WP_000036392.1.73352 WP_000036392.1.73362 WP_000036392.1.73377 WP_000036392.1.73379 WP_000036392.1.73389 WP_000036392.1.7341 WP_000036392.1.73425 WP_000036392.1.73481 WP_000036392.1.73488 WP_000036392.1.73504 WP_000036392.1.73512 WP_000036392.1.7353 WP_000036392.1.73544 WP_000036392.1.7356 WP_000036392.1.73561 WP_000036392.1.73581 WP_000036392.1.73598 WP_000036392.1.7361 WP_000036392.1.73617 WP_000036392.1.73648 WP_000036392.1.73667 WP_000036392.1.73669 WP_000036392.1.73701 WP_000036392.1.7374 WP_000036392.1.73753 WP_000036392.1.73758 WP_000036392.1.73768 WP_000036392.1.73794 WP_000036392.1.73831 WP_000036392.1.73849 WP_000036392.1.7387 WP_000036392.1.73924 WP_000036392.1.73926 WP_000036392.1.73945 WP_000036392.1.73948 WP_000036392.1.73956 WP_000036392.1.73958 WP_000036392.1.73999 WP_000036392.1.74024 WP_000036392.1.74028 WP_000036392.1.74029 WP_000036392.1.74030 WP_000036392.1.74038 WP_000036392.1.74040 WP_000036392.1.74043 WP_000036392.1.74058 WP_000036392.1.74070 WP_000036392.1.74077 WP_000036392.1.74089 WP_000036392.1.74135 WP_000036392.1.74181 WP_000036392.1.74191 WP_000036392.1.74214 WP_000036392.1.74241 WP_000036392.1.74285 WP_000036392.1.7430 WP_000036392.1.74317 WP_000036392.1.7433 WP_000036392.1.74379 WP_000036392.1.74410 WP_000036392.1.74415 WP_000036392.1.74422 WP_000036392.1.7444 WP_000036392.1.74454 WP_000036392.1.74466 WP_000036392.1.74529 WP_000036392.1.74545 WP_000036392.1.74570 WP_000036392.1.74616 WP_000036392.1.74620 WP_000036392.1.74621 WP_000036392.1.74647 WP_000036392.1.74661 WP_000036392.1.74677 WP_000036392.1.74699 WP_000036392.1.74741 WP_000036392.1.74745 WP_000036392.1.74806 WP_000036392.1.74831 WP_000036392.1.74894 WP_000036392.1.74929 WP_000036392.1.74939 WP_000036392.1.74946 WP_000036392.1.74973 WP_000036392.1.75009 WP_000036392.1.75058 WP_000036392.1.7507 WP_000036392.1.75089 WP_000036392.1.75114 WP_000036392.1.75116 WP_000036392.1.75129 WP_000036392.1.75187 WP_000036392.1.75237 WP_000036392.1.75273 WP_000036392.1.75288 WP_000036392.1.75296 WP_000036392.1.75301 WP_000036392.1.75334 WP_000036392.1.75362 WP_000036392.1.75371 WP_000036392.1.75385 WP_000036392.1.75392 WP_000036392.1.75402 WP_000036392.1.75413 WP_000036392.1.75433 WP_000036392.1.75532 WP_000036392.1.75565 WP_000036392.1.75593 WP_000036392.1.75609 WP_000036392.1.75610 WP_000036392.1.75633 WP_000036392.1.75664 WP_000036392.1.75718 WP_000036392.1.75740 WP_000036392.1.75745 WP_000036392.1.75760 WP_000036392.1.75837 WP_000036392.1.75844 WP_000036392.1.75874 WP_000036392.1.75884 WP_000036392.1.75886 WP_000036392.1.75898 WP_000036392.1.75932 WP_000036392.1.75945 WP_000036392.1.75957 WP_000036392.1.76 WP_000036392.1.76020 WP_000036392.1.76024 WP_000036392.1.76081 WP_000036392.1.76097 WP_000036392.1.76102 WP_000036392.1.76115 WP_000036392.1.76116 WP_000036392.1.76122 WP_000036392.1.76156 WP_000036392.1.76164 WP_000036392.1.76170 WP_000036392.1.76186 WP_000036392.1.76252 WP_000036392.1.76256 WP_000036392.1.7629 WP_000036392.1.7633 WP_000036392.1.76339 WP_000036392.1.76364 WP_000036392.1.76366 WP_000036392.1.76417 WP_000036392.1.76434 WP_000036392.1.76445 WP_000036392.1.7646 WP_000036392.1.76471 WP_000036392.1.76510 WP_000036392.1.76532 WP_000036392.1.76548 WP_000036392.1.76558 WP_000036392.1.76572 WP_000036392.1.76576 WP_000036392.1.7660 WP_000036392.1.76641 WP_000036392.1.76651 WP_000036392.1.76653 WP_000036392.1.76673 WP_000036392.1.76706 WP_000036392.1.7672 WP_000036392.1.76721 WP_000036392.1.76724 WP_000036392.1.76756 WP_000036392.1.76760 WP_000036392.1.76788 WP_000036392.1.76799 WP_000036392.1.76806 WP_000036392.1.7684 WP_000036392.1.76854 WP_000036392.1.76875 WP_000036392.1.76880 WP_000036392.1.76899 WP_000036392.1.76916 WP_000036392.1.76932 WP_000036392.1.76973 WP_000036392.1.76988 WP_000036392.1.77016 WP_000036392.1.77038 WP_000036392.1.77047 WP_000036392.1.77080 WP_000036392.1.77087 WP_000036392.1.77090 WP_000036392.1.77111 WP_000036392.1.7712 WP_000036392.1.77180 WP_000036392.1.77193 WP_000036392.1.77241 WP_000036392.1.77244 WP_000036392.1.77292 WP_000036392.1.77299 WP_000036392.1.77349 WP_000036392.1.77384 WP_000036392.1.77390 WP_000036392.1.77431 WP_000036392.1.77440 WP_000036392.1.77501 WP_000036392.1.77512 WP_000036392.1.77513 WP_000036392.1.77514 WP_000036392.1.77529 WP_000036392.1.77549 WP_000036392.1.77555 WP_000036392.1.77563 WP_000036392.1.77575 WP_000036392.1.77596 WP_000036392.1.77629 WP_000036392.1.77692 WP_000036392.1.77702 WP_000036392.1.77713 WP_000036392.1.7772 WP_000036392.1.7782 WP_000036392.1.77825 WP_000036392.1.77837 WP_000036392.1.7784 WP_000036392.1.77851 WP_000036392.1.77898 WP_000036392.1.77900 WP_000036392.1.77918 WP_000036392.1.77923 WP_000036392.1.77960 WP_000036392.1.77975 WP_000036392.1.78026 WP_000036392.1.78035 WP_000036392.1.78048 WP_000036392.1.78076 WP_000036392.1.78096 WP_000036392.1.78100 WP_000036392.1.78107 WP_000036392.1.78110 WP_000036392.1.78120 WP_000036392.1.7814 WP_000036392.1.78166 WP_000036392.1.78168 WP_000036392.1.78170 WP_000036392.1.78192 WP_000036392.1.78195 WP_000036392.1.78201 WP_000036392.1.78259 WP_000036392.1.78291 WP_000036392.1.78301 WP_000036392.1.78309 WP_000036392.1.78320 WP_000036392.1.78352 WP_000036392.1.78382 WP_000036392.1.78383 WP_000036392.1.78388 WP_000036392.1.78407 WP_000036392.1.78410 WP_000036392.1.7861 WP_000036392.1.78618 WP_000036392.1.7862 WP_000036392.1.78626 WP_000036392.1.78661 WP_000036392.1.78673 WP_000036392.1.78674 WP_000036392.1.78676 WP_000036392.1.78715 WP_000036392.1.78735 WP_000036392.1.78738 WP_000036392.1.78761 WP_000036392.1.78771 WP_000036392.1.78802 WP_000036392.1.78830 WP_000036392.1.78835 WP_000036392.1.78862 WP_000036392.1.78871 WP_000036392.1.78874 WP_000036392.1.78881 WP_000036392.1.789 WP_000036392.1.7891 WP_000036392.1.78918 WP_000036392.1.78928 WP_000036392.1.78930 WP_000036392.1.78959 WP_000036392.1.78993 WP_000036392.1.79011 WP_000036392.1.79012 WP_000036392.1.79069 WP_000036392.1.79074 WP_000036392.1.79081 WP_000036392.1.79098 WP_000036392.1.79140 WP_000036392.1.79151 WP_000036392.1.79155 WP_000036392.1.79164 WP_000036392.1.79167 WP_000036392.1.79203 WP_000036392.1.79204 WP_000036392.1.79280 WP_000036392.1.79335 WP_000036392.1.79397 WP_000036392.1.79427 WP_000036392.1.79456 WP_000036392.1.79462 WP_000036392.1.79466 WP_000036392.1.79472 WP_000036392.1.79490 WP_000036392.1.79495 WP_000036392.1.79529 WP_000036392.1.79531 WP_000036392.1.79532 WP_000036392.1.79547 WP_000036392.1.79570 WP_000036392.1.7964 WP_000036392.1.79642 WP_000036392.1.79654 WP_000036392.1.79659 WP_000036392.1.79668 WP_000036392.1.7970 WP_000036392.1.79708 WP_000036392.1.7972 WP_000036392.1.79722 WP_000036392.1.79772 WP_000036392.1.79832 WP_000036392.1.79845 WP_000036392.1.79867 WP_000036392.1.79880 WP_000036392.1.79892 WP_000036392.1.79916 WP_000036392.1.79929 WP_000036392.1.79934 WP_000036392.1.79945 WP_000036392.1.79974 WP_000036392.1.79977 WP_000036392.1.80065 WP_000036392.1.80077 WP_000036392.1.80103 WP_000036392.1.80137 WP_000036392.1.80182 WP_000036392.1.80273 WP_000036392.1.80282 WP_000036392.1.80296 WP_000036392.1.80307 WP_000036392.1.80354 WP_000036392.1.80366 WP_000036392.1.80368 WP_000036392.1.80386 WP_000036392.1.80400 WP_000036392.1.80441 WP_000036392.1.80448 WP_000036392.1.80462 WP_000036392.1.80473 WP_000036392.1.80480 WP_000036392.1.8049 WP_000036392.1.80492 WP_000036392.1.80529 WP_000036392.1.80569 WP_000036392.1.80638 WP_000036392.1.80651 WP_000036392.1.80664 WP_000036392.1.80696 WP_000036392.1.80780 WP_000036392.1.80819 WP_000036392.1.80827 WP_000036392.1.80831 WP_000036392.1.80850 WP_000036392.1.80868 WP_000036392.1.80881 WP_000036392.1.80927 WP_000036392.1.80939 WP_000036392.1.8096 WP_000036392.1.80984 WP_000036392.1.81037 WP_000036392.1.81041 WP_000036392.1.81067 WP_000036392.1.81069 WP_000036392.1.81084 WP_000036392.1.81131 WP_000036392.1.81149 WP_000036392.1.81175 WP_000036392.1.81187 WP_000036392.1.8119 WP_000036392.1.81193 WP_000036392.1.81231 WP_000036392.1.81262 WP_000036392.1.81268 WP_000036392.1.81269 WP_000036392.1.81271 WP_000036392.1.8131 WP_000036392.1.81333 WP_000036392.1.81342 WP_000036392.1.81354 WP_000036392.1.81364 WP_000036392.1.81409 WP_000036392.1.81410 WP_000036392.1.81425 WP_000036392.1.81494 WP_000036392.1.81504 WP_000036392.1.81548 WP_000036392.1.81557 WP_000036392.1.81568 WP_000036392.1.81676 WP_000036392.1.8168 WP_000036392.1.81681 WP_000036392.1.8170 WP_000036392.1.81727 WP_000036392.1.81736 WP_000036392.1.81743 WP_000036392.1.81746 WP_000036392.1.81750 WP_000036392.1.81763 WP_000036392.1.81785 WP_000036392.1.81798 WP_000036392.1.81855 WP_000036392.1.81902 WP_000036392.1.81921 WP_000036392.1.81931 WP_000036392.1.81936 WP_000036392.1.81949 WP_000036392.1.8196 WP_000036392.1.81965 WP_000036392.1.81974 WP_000036392.1.81995 WP_000036392.1.82037 WP_000036392.1.82070 WP_000036392.1.82076 WP_000036392.1.82099 WP_000036392.1.82131 WP_000036392.1.82141 WP_000036392.1.82156 WP_000036392.1.8218 WP_000036392.1.82180 WP_000036392.1.82201 WP_000036392.1.82214 WP_000036392.1.82225 WP_000036392.1.82258 WP_000036392.1.82269 WP_000036392.1.82337 WP_000036392.1.82347 WP_000036392.1.8236 WP_000036392.1.82369 WP_000036392.1.8240 WP_000036392.1.82408 WP_000036392.1.82416 WP_000036392.1.8242 WP_000036392.1.82456 WP_000036392.1.82465 WP_000036392.1.82473 WP_000036392.1.82479 WP_000036392.1.82503 WP_000036392.1.82515 WP_000036392.1.82530 WP_000036392.1.82553 WP_000036392.1.82636 WP_000036392.1.82646 WP_000036392.1.82670 WP_000036392.1.82676 WP_000036392.1.82692 WP_000036392.1.82731 WP_000036392.1.82761 WP_000036392.1.82812 WP_000036392.1.8282 WP_000036392.1.82841 WP_000036392.1.82843 WP_000036392.1.82850 WP_000036392.1.82872 WP_000036392.1.82886 WP_000036392.1.82908 WP_000036392.1.82937 WP_000036392.1.8294 WP_000036392.1.82944 WP_000036392.1.82946 WP_000036392.1.82956 WP_000036392.1.82959 WP_000036392.1.83007 WP_000036392.1.8304 WP_000036392.1.83128 WP_000036392.1.83163 WP_000036392.1.83180 WP_000036392.1.83221 WP_000036392.1.83229 WP_000036392.1.83235 WP_000036392.1.83252 WP_000036392.1.83258 WP_000036392.1.83280 WP_000036392.1.83290 WP_000036392.1.83301 WP_000036392.1.83305 WP_000036392.1.83333 WP_000036392.1.83360 WP_000036392.1.83365 WP_000036392.1.83378 WP_000036392.1.83413 WP_000036392.1.83491 WP_000036392.1.83510 WP_000036392.1.83523 WP_000036392.1.8354 WP_000036392.1.83650 WP_000036392.1.83657 WP_000036392.1.83677 WP_000036392.1.83710 WP_000036392.1.83721 WP_000036392.1.83739 WP_000036392.1.8375 WP_000036392.1.83760 WP_000036392.1.83806 WP_000036392.1.83854 WP_000036392.1.83923 WP_000036392.1.83994 WP_000036392.1.83995 WP_000036392.1.84 WP_000036392.1.8406 WP_000036392.1.84076 WP_000036392.1.84077 WP_000036392.1.84103 WP_000036392.1.84106 WP_000036392.1.84110 WP_000036392.1.84127 WP_000036392.1.84150 WP_000036392.1.84168 WP_000036392.1.84209 WP_000036392.1.84230 WP_000036392.1.84252 WP_000036392.1.84283 WP_000036392.1.8431 WP_000036392.1.84345 WP_000036392.1.84355 WP_000036392.1.84359 WP_000036392.1.84369 WP_000036392.1.84392 WP_000036392.1.84401 WP_000036392.1.8441 WP_000036392.1.84435 WP_000036392.1.84461 WP_000036392.1.84475 WP_000036392.1.84532 WP_000036392.1.84551 WP_000036392.1.84567 WP_000036392.1.84631 WP_000036392.1.84659 WP_000036392.1.84693 WP_000036392.1.84711 WP_000036392.1.84727 WP_000036392.1.84744 WP_000036392.1.84745 WP_000036392.1.84773 WP_000036392.1.84814 WP_000036392.1.84872 WP_000036392.1.84879 WP_000036392.1.84899 WP_000036392.1.849 WP_000036392.1.84945 WP_000036392.1.84967 WP_000036392.1.8497 WP_000036392.1.85004 WP_000036392.1.85014 WP_000036392.1.8502 WP_000036392.1.85039 WP_000036392.1.85040 WP_000036392.1.85094 WP_000036392.1.85134 WP_000036392.1.85147 WP_000036392.1.85153 WP_000036392.1.85178 WP_000036392.1.85180 WP_000036392.1.85190 WP_000036392.1.85217 WP_000036392.1.85273 WP_000036392.1.8533 WP_000036392.1.85338 WP_000036392.1.85339 WP_000036392.1.85408 WP_000036392.1.85433 WP_000036392.1.8545 WP_000036392.1.85481 WP_000036392.1.85483 WP_000036392.1.85511 WP_000036392.1.85512 WP_000036392.1.85541 WP_000036392.1.8556 WP_000036392.1.8557 WP_000036392.1.85606 WP_000036392.1.85615 WP_000036392.1.85617 WP_000036392.1.85635 WP_000036392.1.85646 WP_000036392.1.85663 WP_000036392.1.85665 WP_000036392.1.85669 WP_000036392.1.85671 WP_000036392.1.85672 WP_000036392.1.85675 WP_000036392.1.85688 WP_000036392.1.85703 WP_000036392.1.85728 WP_000036392.1.85746 WP_000036392.1.85777 WP_000036392.1.85811 WP_000036392.1.85854 WP_000036392.1.85855 WP_000036392.1.85864 WP_000036392.1.85886 WP_000036392.1.859 WP_000036392.1.85900 WP_000036392.1.85904 WP_000036392.1.8591 WP_000036392.1.85917 WP_000036392.1.8594 WP_000036392.1.85943 WP_000036392.1.85976 WP_000036392.1.85977 WP_000036392.1.860 WP_000036392.1.86007 WP_000036392.1.86017 WP_000036392.1.8605 WP_000036392.1.86084 WP_000036392.1.8610 WP_000036392.1.86120 WP_000036392.1.8614 WP_000036392.1.86156 WP_000036392.1.86284 WP_000036392.1.86285 WP_000036392.1.86306 WP_000036392.1.86323 WP_000036392.1.86342 WP_000036392.1.86356 WP_000036392.1.8640 WP_000036392.1.8642 WP_000036392.1.86426 WP_000036392.1.86450 WP_000036392.1.86453 WP_000036392.1.86466 WP_000036392.1.86469 WP_000036392.1.86489 WP_000036392.1.86530 WP_000036392.1.86580 WP_000036392.1.86588 WP_000036392.1.86634 WP_000036392.1.86656 WP_000036392.1.86661 WP_000036392.1.86663 WP_000036392.1.86699 WP_000036392.1.8672 WP_000036392.1.86744 WP_000036392.1.86770 WP_000036392.1.8678 WP_000036392.1.86794 WP_000036392.1.86800 WP_000036392.1.86810 WP_000036392.1.86811 WP_000036392.1.86815 WP_000036392.1.8684 WP_000036392.1.86859 WP_000036392.1.86895 WP_000036392.1.86902 WP_000036392.1.86906 WP_000036392.1.8691 WP_000036392.1.86945 WP_000036392.1.86989 WP_000036392.1.87023 WP_000036392.1.87034 WP_000036392.1.87041 WP_000036392.1.87051 WP_000036392.1.87095 WP_000036392.1.87136 WP_000036392.1.87143 WP_000036392.1.87148 WP_000036392.1.87155 WP_000036392.1.8722 WP_000036392.1.87220 WP_000036392.1.87258 WP_000036392.1.87276 WP_000036392.1.87282 WP_000036392.1.87283 WP_000036392.1.87293 WP_000036392.1.87323 WP_000036392.1.8736 WP_000036392.1.87376 WP_000036392.1.87420 WP_000036392.1.87460 WP_000036392.1.87493 WP_000036392.1.87528 WP_000036392.1.87552 WP_000036392.1.87560 WP_000036392.1.87584 WP_000036392.1.8760 WP_000036392.1.87600 WP_000036392.1.87609 WP_000036392.1.87612 WP_000036392.1.87615 WP_000036392.1.87651 WP_000036392.1.87653 WP_000036392.1.87659 WP_000036392.1.8767 WP_000036392.1.87687 WP_000036392.1.87698 WP_000036392.1.87706 WP_000036392.1.87739 WP_000036392.1.87741 WP_000036392.1.87742 WP_000036392.1.87779 WP_000036392.1.87852 WP_000036392.1.87875 WP_000036392.1.87891 WP_000036392.1.87933 WP_000036392.1.87945 WP_000036392.1.87949 WP_000036392.1.87999 WP_000036392.1.88019 WP_000036392.1.88025 WP_000036392.1.88026 WP_000036392.1.8805 WP_000036392.1.8806 WP_000036392.1.88073 WP_000036392.1.8809 WP_000036392.1.881 WP_000036392.1.88145 WP_000036392.1.88165 WP_000036392.1.88174 WP_000036392.1.88199 WP_000036392.1.88214 WP_000036392.1.88222 WP_000036392.1.88291 WP_000036392.1.88293 WP_000036392.1.88299 WP_000036392.1.88313 WP_000036392.1.88359 WP_000036392.1.8837 WP_000036392.1.88393 WP_000036392.1.88407 WP_000036392.1.88414 WP_000036392.1.88423 WP_000036392.1.88444 WP_000036392.1.88446 WP_000036392.1.88458 WP_000036392.1.88501 WP_000036392.1.88538 WP_000036392.1.88547 WP_000036392.1.886 WP_000036392.1.88609 WP_000036392.1.88620 WP_000036392.1.88624 WP_000036392.1.88647 WP_000036392.1.88648 WP_000036392.1.88683 WP_000036392.1.88692 WP_000036392.1.88703 WP_000036392.1.88707 WP_000036392.1.88727 WP_000036392.1.88772 WP_000036392.1.88792 WP_000036392.1.88817 WP_000036392.1.88845 WP_000036392.1.88850 WP_000036392.1.8889 WP_000036392.1.88892 WP_000036392.1.88894 WP_000036392.1.88902 WP_000036392.1.8891 WP_000036392.1.88942 WP_000036392.1.88967 WP_000036392.1.88970 WP_000036392.1.88981 WP_000036392.1.88995 WP_000036392.1.89008 WP_000036392.1.89054 WP_000036392.1.89116 WP_000036392.1.89138 WP_000036392.1.89174 WP_000036392.1.89182 WP_000036392.1.89188 WP_000036392.1.89215 WP_000036392.1.89298 WP_000036392.1.89304 WP_000036392.1.89308 WP_000036392.1.89311 WP_000036392.1.89314 WP_000036392.1.89328 WP_000036392.1.89332 WP_000036392.1.89343 WP_000036392.1.89395 WP_000036392.1.8940 WP_000036392.1.89449 WP_000036392.1.89462 WP_000036392.1.8947 WP_000036392.1.89503 WP_000036392.1.89512 WP_000036392.1.89527 WP_000036392.1.89570 WP_000036392.1.89580 WP_000036392.1.89591 WP_000036392.1.89604 WP_000036392.1.89612 WP_000036392.1.89622 WP_000036392.1.89647 WP_000036392.1.89659 WP_000036392.1.89668 WP_000036392.1.89706 WP_000036392.1.89713 WP_000036392.1.89733 WP_000036392.1.89764 WP_000036392.1.89777 WP_000036392.1.89796 WP_000036392.1.89804 WP_000036392.1.89815 WP_000036392.1.89845 WP_000036392.1.89888 WP_000036392.1.89902 WP_000036392.1.89911 WP_000036392.1.8995 WP_000036392.1.89952 WP_000036392.1.8996 WP_000036392.1.90007 WP_000036392.1.90033 WP_000036392.1.90084 WP_000036392.1.90097 WP_000036392.1.9011 WP_000036392.1.90196 WP_000036392.1.90211 WP_000036392.1.90240 WP_000036392.1.90252 WP_000036392.1.90274 WP_000036392.1.90280 WP_000036392.1.90311 WP_000036392.1.90330 WP_000036392.1.90338 WP_000036392.1.90365 WP_000036392.1.90417 WP_000036392.1.90428 WP_000036392.1.90440 WP_000036392.1.90453 WP_000036392.1.90458 WP_000036392.1.90489 WP_000036392.1.90513 WP_000036392.1.90557 WP_000036392.1.90582 WP_000036392.1.90585 WP_000036392.1.90620 WP_000036392.1.9064 WP_000036392.1.90641 WP_000036392.1.90686 WP_000036392.1.90713 WP_000036392.1.90734 WP_000036392.1.90792 WP_000036392.1.90794 WP_000036392.1.90796 WP_000036392.1.90811 WP_000036392.1.90876 WP_000036392.1.9091 WP_000036392.1.91003 WP_000036392.1.91042 WP_000036392.1.91049 WP_000036392.1.91067 WP_000036392.1.91069 WP_000036392.1.91107 WP_000036392.1.91164 WP_000036392.1.91205 WP_000036392.1.91239 WP_000036392.1.91278 WP_000036392.1.91282 WP_000036392.1.91291 WP_000036392.1.9131 WP_000036392.1.91312 WP_000036392.1.91313 WP_000036392.1.91331 WP_000036392.1.91334 WP_000036392.1.9135 WP_000036392.1.91459 WP_000036392.1.91470 WP_000036392.1.91493 WP_000036392.1.91506 WP_000036392.1.91512 WP_000036392.1.91528 WP_000036392.1.91557 WP_000036392.1.91564 WP_000036392.1.91597 WP_000036392.1.91625 WP_000036392.1.91628 WP_000036392.1.91655 WP_000036392.1.9166 WP_000036392.1.91702 WP_000036392.1.91715 WP_000036392.1.91724 WP_000036392.1.91732 WP_000036392.1.91788 WP_000036392.1.91864 WP_000036392.1.9187 WP_000036392.1.91870 WP_000036392.1.91880 WP_000036392.1.91984 WP_000036392.1.92013 WP_000036392.1.92018 WP_000036392.1.92044 WP_000036392.1.92060 WP_000036392.1.92087 WP_000036392.1.92093 WP_000036392.1.92098 WP_000036392.1.92099 WP_000036392.1.92108 WP_000036392.1.92156 WP_000036392.1.92171 WP_000036392.1.92172 WP_000036392.1.92183 WP_000036392.1.92208 WP_000036392.1.92213 WP_000036392.1.92240 WP_000036392.1.92243 WP_000036392.1.92268 WP_000036392.1.92310 WP_000036392.1.92318 WP_000036392.1.92327 WP_000036392.1.92375 WP_000036392.1.92394 WP_000036392.1.92399 WP_000036392.1.92411 WP_000036392.1.92443 WP_000036392.1.92470 WP_000036392.1.92477 WP_000036392.1.92482 WP_000036392.1.92529 WP_000036392.1.92531 WP_000036392.1.92545 WP_000036392.1.92570 WP_000036392.1.92575 WP_000036392.1.92588 WP_000036392.1.926 WP_000036392.1.92633 WP_000036392.1.92646 WP_000036392.1.92649 WP_000036392.1.92659 WP_000036392.1.92669 WP_000036392.1.92671 WP_000036392.1.92676 WP_000036392.1.92705 WP_000036392.1.9271 WP_000036392.1.92729 WP_000036392.1.92734 WP_000036392.1.92738 WP_000036392.1.92758 WP_000036392.1.92786 WP_000036392.1.92810 WP_000036392.1.92823 WP_000036392.1.92827 WP_000036392.1.92842 WP_000036392.1.92875 WP_000036392.1.92879 WP_000036392.1.92895 WP_000036392.1.92936 WP_000036392.1.92939 WP_000036392.1.92975 WP_000036392.1.92987 WP_000036392.1.92988 WP_000036392.1.93007 WP_000036392.1.93022 WP_000036392.1.93086 WP_000036392.1.93101 WP_000036392.1.93103 WP_000036392.1.93105 WP_000036392.1.93111 WP_000036392.1.93118 WP_000036392.1.93121 WP_000036392.1.93136 WP_000036392.1.93155 WP_000036392.1.93168 WP_000036392.1.93184 WP_000036392.1.93213 WP_000036392.1.93221 WP_000036392.1.93223 WP_000036392.1.93239 WP_000036392.1.93275 WP_000036392.1.93302 WP_000036392.1.93322 WP_000036392.1.9336 WP_000036392.1.93365 WP_000036392.1.93376 WP_000036392.1.93387 WP_000036392.1.93469 WP_000036392.1.93511 WP_000036392.1.93512 WP_000036392.1.93543 WP_000036392.1.93604 WP_000036392.1.93635 WP_000036392.1.93650 WP_000036392.1.93656 WP_000036392.1.93657 WP_000036392.1.93662 WP_000036392.1.937 WP_000036392.1.93705 WP_000036392.1.9374 WP_000036392.1.93741 WP_000036392.1.9375 WP_000036392.1.93754 WP_000036392.1.93780 WP_000036392.1.93803 WP_000036392.1.93804 WP_000036392.1.93828 WP_000036392.1.93837 WP_000036392.1.93842 WP_000036392.1.93843 WP_000036392.1.93875 WP_000036392.1.9389 WP_000036392.1.93909 WP_000036392.1.93919 WP_000036392.1.93938 WP_000036392.1.93956 WP_000036392.1.93984 WP_000036392.1.9399 WP_000036392.1.93994 WP_000036392.1.94017 WP_000036392.1.94070 WP_000036392.1.94071 WP_000036392.1.94072 WP_000036392.1.94079 WP_000036392.1.94097 WP_000036392.1.94107 WP_000036392.1.94142 WP_000036392.1.94162 WP_000036392.1.94168 WP_000036392.1.94198 WP_000036392.1.94215 WP_000036392.1.94303 WP_000036392.1.9432 WP_000036392.1.94354 WP_000036392.1.94365 WP_000036392.1.94379 WP_000036392.1.94380 WP_000036392.1.94383 WP_000036392.1.94390 WP_000036392.1.94415 WP_000036392.1.94458 WP_000036392.1.94492 WP_000036392.1.94510 WP_000036392.1.94527 WP_000036392.1.94562 WP_000036392.1.94565 WP_000036392.1.94573 WP_000036392.1.94579 WP_000036392.1.94584 WP_000036392.1.94586 WP_000036392.1.94593 WP_000036392.1.94650 WP_000036392.1.94659 WP_000036392.1.94662 WP_000036392.1.94674 WP_000036392.1.94700 WP_000036392.1.94717 WP_000036392.1.94745 WP_000036392.1.94782 WP_000036392.1.94796 WP_000036392.1.94815 WP_000036392.1.94820 WP_000036392.1.94849 WP_000036392.1.94850 WP_000036392.1.94851 WP_000036392.1.94864 WP_000036392.1.94952 WP_000036392.1.94959 WP_000036392.1.94967 WP_000036392.1.95006 WP_000036392.1.95051 WP_000036392.1.95055 WP_000036392.1.95076 WP_000036392.1.95085 WP_000036392.1.95094 WP_000036392.1.95099 WP_000036392.1.95121 WP_000036392.1.95133 WP_000036392.1.95152 WP_000036392.1.95165 WP_000036392.1.95235 WP_000036392.1.95239 WP_000036392.1.95246 WP_000036392.1.95249 WP_000036392.1.9525 WP_000036392.1.95255 WP_000036392.1.95265 WP_000036392.1.95282 WP_000036392.1.9530 WP_000036392.1.95338 WP_000036392.1.95404 WP_000036392.1.95412 WP_000036392.1.95530 WP_000036392.1.95546 WP_000036392.1.95547 WP_000036392.1.95590 WP_000036392.1.95623 WP_000036392.1.95625 WP_000036392.1.95630 WP_000036392.1.95675 WP_000036392.1.95701 WP_000036392.1.95716 WP_000036392.1.95729 WP_000036392.1.9574 WP_000036392.1.95776 WP_000036392.1.95805 WP_000036392.1.95826 WP_000036392.1.95884 WP_000036392.1.95890 WP_000036392.1.95906 WP_000036392.1.95911 WP_000036392.1.96025 WP_000036392.1.96042 WP_000036392.1.96044 WP_000036392.1.96045 WP_000036392.1.96054 WP_000036392.1.96094 WP_000036392.1.96127 WP_000036392.1.96139 WP_000036392.1.96144 WP_000036392.1.96188 WP_000036392.1.96190 WP_000036392.1.96211 WP_000036392.1.96212 WP_000036392.1.96317 WP_000036392.1.96319 WP_000036392.1.9633 WP_000036392.1.96335 WP_000036392.1.96343 WP_000036392.1.96359 WP_000036392.1.96429 WP_000036392.1.9644 WP_000036392.1.96469 WP_000036392.1.96497 WP_000036392.1.96500 WP_000036392.1.96533 WP_000036392.1.96539 WP_000036392.1.96552 WP_000036392.1.96555 WP_000036392.1.96563 WP_000036392.1.96590 WP_000036392.1.96610 WP_000036392.1.96625 WP_000036392.1.96635 WP_000036392.1.9664 WP_000036392.1.96640 WP_000036392.1.96642 WP_000036392.1.96662 WP_000036392.1.96675 WP_000036392.1.9670 WP_000036392.1.96731 WP_000036392.1.96732 WP_000036392.1.96750 WP_000036392.1.96758 WP_000036392.1.96761 WP_000036392.1.96771 WP_000036392.1.96792 WP_000036392.1.96801 WP_000036392.1.96803 WP_000036392.1.96890 WP_000036392.1.96902 WP_000036392.1.96917 WP_000036392.1.96925 WP_000036392.1.96938 WP_000036392.1.96946 WP_000036392.1.96957 WP_000036392.1.96978 WP_000036392.1.97015 WP_000036392.1.97026 WP_000036392.1.97028 WP_000036392.1.97079 WP_000036392.1.97089 WP_000036392.1.97145 WP_000036392.1.97154 WP_000036392.1.97184 WP_000036392.1.97190 WP_000036392.1.97287 WP_000036392.1.97291 WP_000036392.1.97318 WP_000036392.1.97368 WP_000036392.1.97369 WP_000036392.1.97386 WP_000036392.1.97413 WP_000036392.1.97422 WP_000036392.1.97441 WP_000036392.1.97497 WP_000036392.1.97505 WP_000036392.1.97534 WP_000036392.1.97594 WP_000036392.1.97597 WP_000036392.1.97599 WP_000036392.1.97606 WP_000036392.1.97613 WP_000036392.1.97615 WP_000036392.1.97620 WP_000036392.1.97628 WP_000036392.1.97646 WP_000036392.1.97690 WP_000036392.1.97693 WP_000036392.1.97727 WP_000036392.1.97732 WP_000036392.1.97736 WP_000036392.1.9775 WP_000036392.1.97768 WP_000036392.1.97819 WP_000036392.1.97840 WP_000036392.1.97846 WP_000036392.1.97873 WP_000036392.1.97938 WP_000036392.1.97983 WP_000036392.1.97986 WP_000036392.1.98006 WP_000036392.1.98019 WP_000036392.1.98022 WP_000036392.1.98036 WP_000036392.1.98080 WP_000036392.1.98086 WP_000036392.1.98107 WP_000036392.1.9811 WP_000036392.1.98110 WP_000036392.1.98146 WP_000036392.1.98158 WP_000036392.1.98201 WP_000036392.1.98219 WP_000036392.1.98236 WP_000036392.1.98263 WP_000036392.1.98392 WP_000036392.1.9841 WP_000036392.1.98418 WP_000036392.1.98438 WP_000036392.1.98446 WP_000036392.1.98448 WP_000036392.1.98457 WP_000036392.1.98483 WP_000036392.1.98495 WP_000036392.1.9850 WP_000036392.1.98502 WP_000036392.1.98531 WP_000036392.1.98577 WP_000036392.1.98607 WP_000036392.1.98608 WP_000036392.1.9863 WP_000036392.1.98676 WP_000036392.1.98677 WP_000036392.1.98731 WP_000036392.1.98760 WP_000036392.1.98762 WP_000036392.1.9877 WP_000036392.1.98801 WP_000036392.1.98818 WP_000036392.1.98899 WP_000036392.1.9898 WP_000036392.1.99073 WP_000036392.1.99098 WP_000036392.1.99107 WP_000036392.1.99163 WP_000036392.1.99184 WP_000036392.1.99197 WP_000036392.1.99219 WP_000036392.1.99255 WP_000036392.1.99267 WP_000036392.1.99276 WP_000036392.1.99278 WP_000036392.1.99327 WP_000036392.1.99335 WP_000036392.1.99339 WP_000036392.1.99350 WP_000036392.1.99360 WP_000036392.1.99363 WP_000036392.1.99369 WP_000036392.1.99388 WP_000036392.1.99397 WP_000036392.1.99463 WP_000036392.1.99483 WP_000036392.1.99531 WP_000036392.1.99546 WP_000036392.1.99579 WP_000036392.1.99595 WP_000036392.1.99646 WP_000036392.1.99657 WP_000036392.1.99660 WP_000036392.1.99671 WP_000036392.1.99676 WP_000036392.1.99712 WP_000036392.1.99764 WP_000036392.1.99783 WP_000036392.1.99813 WP_000036392.1.99829 WP_000036392.1.99837 WP_000036392.1.99841 WP_000036392.1.99858 WP_000036392.1.99889 WP_000036392.1.9992 WP_000036392.1.99958 WP_000036392.1.99996 1a2o_A 1a2o_B gi|409249635|ref|YP_006885457.1| gi|378984483|ref|YP_005247638.1| gi|379701102|ref|YP_005242830.1| gi|525837962|ref|YP_008254876.1| 209261.t0960 295319.SPA0951 454166.SeAg_B1205 554290.SSPA0885 99287.STM1917 gi|525947024|ref|YP_008308300.1| gi|538362539|ref|YP_008505824.1| gi|56413163|ref|YP_150238.1| gi|488653495|ref|YP_007925298.1| gi|378699789|ref|YP_005181746.1| 1a2oA gi|550901316|ref|YP_008670408.1| gi|378445308|ref|YP_005232940.1| ABAK02000001|CDS_1393828-1392779 ABAM02000001|CDS_2473666-2472617 ABAN01000018|CDS_20170-21219 ABAO01000035|CDS_29474-28425 ABEI01000024|CDS_21496-22545 ABFF01000008|CDS_197907-196858 ABFG01000001|CDS_309573-310622 AE006468|CDS_2013739-2012690 AE014613|CDS_1047782-1048831 CP000026|CDS_1023336-1024385 CP001138|CDS_1190871-1191920 CP001363|CDS_2025143-2024094 FM200053|CDS_1017346-1018395 FN424405|CDS_1997249-1996200 NZ_ACBF01000013|CDS_89858-90907 gi|525857994|ref|YP_008261186.1| gi|378989263|ref|YP_005252427.1| gi|378959116|ref|YP_005216602.1| gi|197251203|ref|YP_002146104.1| gi|16765259|ref|NP_460874.1| gi|383496596|ref|YP_005397285.1| gi|378450526|ref|YP_005237885.1| gi|563652669|ref|YP_008860731.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]