SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1a3gA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1a3gA
Domain Number 1 Region: 6-303
Classification Level Classification E-value
Superfamily D-aminoacid aminotransferase-like PLP-dependent enzymes 4.32e-158
Family D-aminoacid aminotransferase-like PLP-dependent enzymes 0.000000038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1a3gA   PDB: 1a3g   SUPERFAMILY: 1a3gA
Sequence length 308
Comment (A:)
Sequence
ttkkadyiwfngemvrwedakvhvmshalhygtsvfegircydshkgpvvfrhrehmqrl
hdsakiyrfpvsqsidelmeacrdvirknnltsayirplifvgdvgmgvnppagystdvi
iaafpwgaylgaealeqgidamvsswnraapntiptaakaggnylssllvgsearrhgyq
egialdvngyisegagenlfevkdgvlftppftssalpgitrdaiiklakelgievreqv
lsreslyladevfmsgtaaeitpvrsvdgiqvgegrcgpvtkriqqaffglftgetedkw
gwldqvnq
Download sequence
Identical sequences 1a3g_A 1a3g_B 1a3g_C 1a3gA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]