SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1a5jA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1a5jA
Domain Number 1 Region: 4-100
Classification Level Classification E-value
Superfamily Homeodomain-like 1.72e-34
Family Myb/SANT domain 0.0005
Further Details:      
 
Domain Number 2 Region: 59-106
Classification Level Classification E-value
Superfamily CATH 4.8e-24
Family CATH 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1a5jA   PDB: 1a5j
Sequence length 110
Comment (A:)
Sequence
gipdlvkgpwtkeedqkvielvkkygtkqwtliakhlkgrlgkqcrerwhnhlnpevkks
swteeedriifeahkvlgnrwaeiakllpgrtdnavknhwnstikrkvdt
Download sequence
Identical sequences 1a5j_A 1a5jA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]