SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1a68A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1a68A
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily POZ domain 1.35e-39
Family Tetramerization domain of potassium channels 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1a68A   PDB: 1a68   SUPERFAMILY: 1a68A
Sequence length 95
Comment (A:)
Sequence
mervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyf
yqsggrlrrpvnvpldvfseeikfyelgenafery
Download sequence
Identical sequences 1a68A cath|current|1a68A00/66-152 1a68_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]