SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1a6iA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1a6iA
Domain Number 1 Region: 67-200
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 9.23e-40
Family Tetracyclin repressor-like, C-terminal domain 0.000067
Further Details:      
 
Domain Number 2 Region: 4-66
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000397
Family Tetracyclin repressor-like, N-terminal domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1a6iA   PDB: 1a6i
Sequence length 217
Comment (A:)
Sequence
srldkskvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaveila
rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
geqaflhgleslirgfevqltallqivggdkliipfc
Download sequence
Identical sequences 1a6iA 1a6i_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]