SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1a6lA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1a6lA
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.96e-24
Family 7-Fe ferredoxin 0.00000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1a6lA   PDB: 1a6l   SUPERFAMILY: 1a6lA
Sequence length 106
Comment (A:)
Sequence
afvvtdncikckycdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
Download sequence
Identical sequences 000066988|e1a6lA1|205.1.1.49|A:1-106 cath|current|1a6lA00/1-106 d1a6la_ 1a6lA 1a6l_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]