SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1aa0A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1aa0A
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily Fibritin 2.78e-42
Family Fibritin 0.000000671
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1aa0A   PDB: 1aa0   SUPERFAMILY: 1aa0A
Sequence length 113
Comment (A:)
Sequence
vsglnnavqnlqveignnsagikgqvvalntlvngtnpngstveergltnsikanetnia
svtqevntakgnisslqgdvqalqeagyipeaprdgqayvrkdgewvllstfl
Download sequence
Identical sequences cath|current|1aa0A00/371-483 d1aa0a_ 1aa0_A 1aa0A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]