SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ae9A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ae9A
Domain Number 1 Region: 2-164
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 1.28e-36
Family Lambda integrase-like, catalytic core 0.000000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ae9A   PDB: 1ae9   SUPERFAMILY: 1ae9A
Sequence length 179
Comment (A:)
Sequence
rsrltadeylkiyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqskt
gvkiaiptalhidalgismketldkckeilggetiiastrreplssgtvsryfmrarkas
glsfegdpptfhelrslsarlyekqisdkfaqhllghksdtmasqfrddrgrewdkiei
Download sequence
Identical sequences 1ae9A 1ae9_A 1ae9_B cath|current|1ae9A00/177-355 cath|current|1ae9B00/177-355 d1ae9a_ d1ae9b_ d1z1ga2 d1z1gb2 d1z1gc2 d1z1gd2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]