SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1aeiA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1aeiA
Domain Number 1 Region: 3-312
Classification Level Classification E-value
Superfamily Annexin 1.61e-182
Family Annexin 0.0000000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1aeiA   PDB: 1aei   SUPERFAMILY: 1aeiA
Sequence length 315
Comment (A:)
Sequence
vvqgtvkphasfnsredaetlrkamkgigtdeksithilatrsnaqrqqiktdyttlfgk
hledelkselsgnyeaaalallrkpdeflaeqlhaamkglgtdenalidilctqsnaqih
aikaafkllykedlekeiisetsgnfqrllvsmlqggrkedepvnaahaaedaaaiyqag
egqigtdesrfnavlatrsypqlhqifheyskisnktilqaienefsgdikngllaivks
venrfayfaerlhhamkglgtsdktlirilvsrseidlaniketfqamygkslyefiadd
csgdykdlllqitgh
Download sequence
Identical sequences 1aeiA d1aeia_ d1aeib_ d1aeic_ d1aeid_ d1aeie_ d1aeif_ 1aei_A 1aei_B 1aei_C 1aei_D 1aei_E 1aei_F

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]