SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1afiA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1afiA
Domain Number 1 Region: 4-66
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 4.76e-23
Family HMA, heavy metal-associated domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1afiA   PDB: 1afi   SUPERFAMILY: 1afiA
Sequence length 72
Comment (A:)
Sequence
atqtvtlavpgmtcaacpitvkkalskvegvskvdvgfekreavvtfddtkasvqkltka
tadagypssvkq
Download sequence
Identical sequences 000064392|e2hqiA1|304.3.1.7|A:1-72 000064393|e1afiA1|304.3.1.7|A:1-72 000064394|e1afjA1|304.3.1.7|A:1-72 cath|current|1afiA00/1-72 cath|current|1afjA00/1-72 cath|current|2hqiA00/1-72 d1afia_ d1afja_ d2hqia_ 1afi_A 1afj_A 2hqi_A 1afiA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]