SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1akhA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1akhA
Domain Number 1 Region: 4-61
Classification Level Classification E-value
Superfamily Homeodomain-like 4.99e-16
Family Homeodomain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1akhA   PDB: 1akh   SUPERFAMILY: 1akhA
Sequence length 61
Comment (A:)
Sequence
kkekspkgkssispqarafleevfrrkqslnskekeevakkcgitplqvrvwfinkrmrs
k
Download sequence
Identical sequences 1akh_A 1akhA cath|current|1akhA00/77-125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]