SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1alaA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1alaA
Domain Number 1 Region: 6-320
Classification Level Classification E-value
Superfamily Annexin 5.93e-194
Family Annexin 0.0000000513
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1alaA   PDB: 1ala   SUPERFAMILY: 1alaA
Sequence length 321
Comment (A:)
Sequence
makytrgtvtafspfdaradaealrkamkgmgtdeetilkiltsrnnaqrqeiasafktl
fgrdlvddlkseltgkfetlmvslmrparifdahalkhaikgagtnekvlteilasrtpa
evqnikqvymqeyeanledkitgetsghfqrllvvllqanrdpdgrveealvekdaqvlf
ragelkwgtdeetfitilgtrsvshlrrvfdkymtisgfqieetidretsgdleklllav
vkcirsvpayfaetlyysmkgagtdddtlirvmvsrseidlldirhefrknfakslyqmi
qkdtsgdyrkallllcggdde
Download sequence
Identical sequences 1ala_A 1alaA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]