SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1an9A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1an9A
Domain Number 1 Region: 1-208,272-334
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.68e-32
Family D-aminoacid oxidase, N-terminal domain 0.00000000562
Further Details:      
 
Domain Number 2 Region: 195-287
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.39e-24
Family D-aminoacid oxidase-like 0.0000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1an9A   PDB: 1an9
Sequence length 340
Comment (A:)
Sequence
mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
sntevihnyghggygltihwgcalevaklfgkvleernll
Download sequence
Identical sequences 1an9_A 1an9_B 1evi_A 1evi_B 1an9A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]