SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1anxA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1anxA
Domain Number 1 Region: 5-319
Classification Level Classification E-value
Superfamily Annexin 2.86e-192
Family Annexin 0.000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1anxA   PDB: 1anx   SUPERFAMILY: 1anxA
Sequence length 319
Comment (A:)
Sequence
AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLF
GRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEE
LRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQ
AGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVV
KSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIK
GDTSGDYKKALLLLCGEDD
Download sequence
Identical sequences d1anwa_ d1anwb_ 1anw_A 1anw_B 1anx_A 1anx_B 1anx_C 1anxA ENSPTRP00000054465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]