SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1aszA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1aszA
Domain Number 1 Region: 151-489
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.87e-94
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000000133
Further Details:      
 
Domain Number 2 Region: 5-135
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.98e-36
Family Anticodon-binding domain 0.00000442
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1aszA   PDB: 1asz
Sequence length 490
Comment (A:)
Sequence
edtakdnygklpliqsrdsdrtgqkrvkfvdldeakdsdkevlfrarvhntrqqgatlaf
ltlrqqasliqglvkankegtisknmvkwagslnlesivlvrgivkkvdepiksatvqnl
eihitkiytisetpealpilledasrseaeaeaaglpvvnldtrldyrvidlrtvtnqai
friqagvcelfreylatkkftevhtpkllgapseggssvfevtyfkgkaylaqspqfnkq
qlivadfervyeigpvfraensnthrhmteftgldmemafeehyhevldtlselfvfifs
elpkrfaheielvrkqypveefklpkdgkmvrltykegiemlraagkeigdfedlstene
kflgklvrdkydtdfyildkfpleirpfytmpdpanpkysnsydffmrgeeilsgaqrih
dhallqermkahglspedpglkdycdgfsygcpphagggiglervvmfyldlknirrasl
fprdpkrlrp
Download sequence
Identical sequences 1asy_A 1asy_B 1asz_A 1asz_B 1aszA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]