SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1atiA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1atiA
Domain Number 1 Region: 5-403
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.22e-121
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000000082
Further Details:      
 
Domain Number 2 Region: 387-503
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.56e-28
Family Anticodon-binding domain of Class II aaRS 0.00000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1atiA   PDB: 1ati
Sequence length 505
Comment (A:)
Sequence
aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
egldasvlthrlvlhysgheatfadpmvdnritkkryrldhllkeqpeevlkrlyramev
eeenlhalvqammqaperaggamtaagvldpasgepgdwtppryfnmmfqdlrgprggrg
llaylrpetaqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmei
eyfvrpgedeywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfph
gslelegiaqrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviep
sagvdrgvlallaeaftreelpngeerivlklkpqlapikvaviplvknrpeiteyakrl
karllalglgrvlyedtgnigkayrrhdevgtpfavtvdydtigqskdgttrlkdtvtvr
drdtmeqirlhvdelegflrerlrw
Download sequence
Identical sequences 1ati_A 1ati_B 1atiA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]