SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1au7A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1au7A
Domain Number 1 Region: 5-70
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 7.51e-51
Family POU-specific domain 0.0018
Further Details:      
 
Domain Number 2 Region: 80-145
Classification Level Classification E-value
Superfamily Homeodomain-like 5.35e-18
Family Homeodomain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1au7A   PDB: 1au7
Sequence length 146
Comment (A:)
Sequence
gmraleqfanefkvrriklgytqtnvgealaavhgsefsqtticrfenlqlsfknacklk
ailskwleeaeqvgalynekvganerkrkrrttisiaakdalerhfgehskpssqeimrm
aeelnlekevvrvwfcnrrqrekrvk
Download sequence
Identical sequences 1au7A 1au7_A 1au7_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]