SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1avcA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1avcA
Domain Number 1 Region: 11-325
Classification Level Classification E-value
Superfamily Annexin 1.25e-193
Family Annexin 0.00000004
Further Details:      
 
Domain Number 2 Region: 355-673
Classification Level Classification E-value
Superfamily Annexin 1.1e-181
Family Annexin 0.0000000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1avcA   PDB: 1avc
Sequence length 673
Comment (A:)
Sequence
makiaqgakyrgsirdfpdfnpsqdaetlynamkgfgsdkeaiinlitsrsnkqrqeicq
nykslygkdliadlkyeltgkferlivglmrppayadakeikdaisgigtdekclieila
srtneqihqlvaaykdayerdleaditgdtsghfrkmlvvllqgtreeddvvsedlvqqd
vqdlyeagelkwgtdeaqfiyilgnrskqhlrlvfdeylkttgkpieasirgelsgdfek
lmlavvkcirstaeyfaerlfkamkglgtrdntlirimvsrseldmldireifrtkyeks
lysmikndtsgeykktllklcggdddaagqffpeaaqvayqmwelsavarvelkgtvrpa
gdfnpdadakalrkamkglgtdedtiidiithrsnaqrqqirqtfkshfgrdlmadlkse
lsgdlarlilglmmppahydakqlkkamegagtdekalieilatrtnaeiqainkayked
yhktledalssdtsghfkrilislatgnreeggedreraredaqvaaeileiadttsgdk
ssletrfmmilctrsypdlrrvfqefvkmtnydvehtikkemsgdvrdvfvaivqsvknk
plffadklyksmkgagteektltrimvsrseidllnirrefiekydkslhqaiegdtsgh
flkallaicgged
Download sequence
Identical sequences 1avc_A 1avcA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]