SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1avrA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1avrA
Domain Number 1 Region: 6-320
Classification Level Classification E-value
Superfamily Annexin 2.86e-192
Family Annexin 0.000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1avrA   PDB: 1avr   SUPERFAMILY: 1avrA
Sequence length 320
Comment (A:)
Sequence
MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTL
FGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE
ELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALF
QAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAV
VKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMI
KGDTSGDYKKALLLLCGEDD
Download sequence
Identical sequences A0A2J8LX18 A0A2J8XPS3 P08758 Q5R1W0 V9HWE0
9598.ENSPTRP00000028177 9606.ENSP00000296511 ENSP00000296511 1avrA ENSP00000296511 NP_001009099.1.37143 NP_001145.1.87134 NP_001145.1.92137 XP_003816466.1.60992 ENSP00000296511 1avh_A 1avh_B 1avr_A 1hak_A 1hak_B 1sav_A 2xo3_A ENSPTRP00000028177 gi|4502107|ref|NP_001145.1| ENSPTRP00000028177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]