SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1awdA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1awdA
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.87e-48
Family 2Fe-2S ferredoxin-related 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1awdA   PDB: 1awd   SUPERFAMILY: 1awdA
Sequence length 94
Comment (A:)
Sequence
YKVTLKTPSGEETIECPEDTYILDAAEEAGLDLPYSCRAGACSSCAGKVESGEVDQSDQS
FLDDAQMGKGFVLTCVAYPTSDVTILTHQEAALY
Download sequence
Identical sequences P56408
cath|current|1awdA00/1-94 d1awda_ 1awd_A 1awdA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]