SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ay0A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ay0A
Domain Number 1 Region: 11-333
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.28e-209
Family TK-like PP module 0.00000126
Further Details:      
 
Domain Number 2 Region: 338-532
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.7e-114
Family TK-like Pyr module 0.00024
Further Details:      
 
Domain Number 3 Region: 544-668
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.46e-52
Family Transketolase C-terminal domain-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ay0A   PDB: 1ay0
Sequence length 680
Comment (A:)
Sequence
mtqftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinr
drfvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgq
gisnavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnl
iaiyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdk
ptlikmtttigygslhagshsvagaplkaddvkqlkskfgfnpdksfvvpqevydhyqkt
ilkpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrk
lsetvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygireha
mgaimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpt
hqpietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssie
saskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqple
yrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaera
qktiafykgdklisplkkaf
Download sequence
Identical sequences 1ay0A 1ay0_A 1ay0_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]