SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ayfA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ayfA
Domain Number 1 Region: 3-105
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.72e-46
Family 2Fe-2S ferredoxin-related 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ayfA   PDB: 1ayf   SUPERFAMILY: 1ayfA
Sequence length 105
Comment (A:)
Sequence
edkitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlifeqhi
fekleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvp
Download sequence
Identical sequences 1ayfA cath|current|1ayfA00/6-108 cath|current|1ayfB00/5-108 1ayf_A 1ayf_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]