SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1b0tA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1b0tA
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 5.45e-25
Family 7-Fe ferredoxin 0.00000428
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1b0tA   PDB: 1b0t   SUPERFAMILY: 1b0tA
Sequence length 106
Comment (A:)
Sequence
afvvtdncikckytkcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitedkdplpdaedwdgvkgklqhler
Download sequence
Identical sequences 1b0tA 1b0t_A 000067002|e1b0tA1|205.1.1.3|A:1-106 cath|current|1b0tA00/1-106 d1b0ta_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]