SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1b47A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1b47A
Domain Number 1 Region: 6-130
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 1.24e-112
Family N-terminal domain of cbl (N-cbl) 0.00076
Further Details:      
 
Domain Number 2 Region: 219-304
Classification Level Classification E-value
Superfamily SH2 domain 2.11e-91
Family SH2 domain 0.0087
Further Details:      
 
Domain Number 3 Region: 133-217
Classification Level Classification E-value
Superfamily EF-hand 1.99e-82
Family EF-hand modules in multidomain proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1b47A   PDB: 1b47
Sequence length 304
Comment (A:)
Sequence
ppgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkm
etlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelk
gifpsglfqgdtfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalks
tidltcndyisvfefdiftrlfqpwssllrnwnslavthpgymafltydevkarlqkfih
kpgsyifrlsctrlgqwaigyvtadgnilqtiphnkplfqalidgfregfylfpdgrnqn
pdlt
Download sequence
Identical sequences 1b47A 1b47_A 1b47_B 1b47_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]