SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1b72B from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1b72B
Domain Number 1 Region: 8-60
Classification Level Classification E-value
Superfamily Homeodomain-like 1.6e-31
Family Homeodomain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1b72B   PDB: 1b72   SUPERFAMILY: 1b72B
Sequence length 87
Comment (B:)
Sequence
arrkrrnfnkqateilneyfyshlsnpypseeakeelakkcgitvsqvsnwfgnkriryk
knigkfqeeaniyaaktavtatnvsah
Download sequence
Identical sequences 1b72B 1b72_B cath|current|1b72B00/235-307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]