SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1b76A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1b76A
Domain Number 1 Region: 5-340
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.13e-106
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000000119
Further Details:      
 
Domain Number 2 Region: 324-440
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.25e-28
Family Anticodon-binding domain of Class II aaRS 0.00000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1b76A   PDB: 1b76
Sequence length 442
Comment (A:)
Sequence
aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
egldasvlthrlvlhysgheatfadpmvdnakarywtppryfnmmfqdlrgprggrglla
ylrpetaqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmeieyf
vrpgedeywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfphgsl
elegiaqrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviepsag
vdrgvlallaeaftreelpngeerivlklkpqlapikvaviplvknrpeiteyakrlkar
llalglgrvlyedtgnigkayrrhdevgtpfavtvdydtigqskdgttrlkdtvtvrdrd
tmeqirlhvdelegflrerlrw
Download sequence
Identical sequences 1b76A 1b76_A 1b76_B 1ggm_A 1ggm_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]