SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1b78A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1b78A
Domain Number 1 Region: 10-189
Classification Level Classification E-value
Superfamily ITPase-like 8.7e-77
Family ITPase (Ham1) 0.000000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1b78A   PDB: 1b78   SUPERFAMILY: 1b78A
Sequence length 193
Comment (A:)
Sequence
MQRTLGEIMKIYFATGNPNKIKEANIILKDLKDVEIEQIKISYPEIQGTLEEVAEFGAKW
VYNILKKPVIVEDSGFFVEALNGFPGTYSKFVQETIGNEGILKLLEGKDNRNAYFKTVIG
YCDENGVRLFKGIVKGRVSEEIRSKGYGFAYDSIFIPEEEERTFAEMTTEEKSQISHRKK
AFEEFKKFLLDRI
Download sequence
Identical sequences 243232.MJ0226 cath|current|1b78A00/10-193 cath|current|1b78B00/10-193 cath|current|2mjpA00/10-193 cath|current|2mjpB00/10-193 1b78A 1b78_A 1b78_B 2mjp_A 2mjp_B gi|15668399|ref|NP_247195.1| BSGCAIR30511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]