SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1b8aA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1b8aA
Domain Number 1 Region: 95-437
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.32e-99
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000000784
Further Details:      
 
Domain Number 2 Region: 3-101
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.32e-33
Family Anticodon-binding domain 0.0000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1b8aA   PDB: 1b8a
Sequence length 438
Comment (A:)
Sequence
myrthysseiteelngqkvkvagwvwevkdlggikflwirdrdgivqitapkkkvdpelf
klipklrsedvvavegvvnftpkaklgfeilpekivvlnraetplpldptgkvkaeldtr
lnnrfmdlrrpevmaifkirssvfkavrdffhengfieihtpkiiatateggtelfpmky
feedaflaespqlykeimmasgldrvyeiapifraeehnttrhlneawsidsemafiede
eevmsflerlvahainyvrehnakeldilnfeleepklpfprvsydkaleilgdlgkeip
wgedidtegerllgkymmenenaplyflyqypseakpfyimkydnkpeicrafdleyrgv
eissggqrehrhdilveqikekglnpesfefylkafrygmpphggfglgaerlikqmldl
pnirevilfprdrrrltp
Download sequence
Identical sequences 1b8a_A 1b8a_B 1b8aA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]