SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1b8iA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1b8iA
Domain Number 1 Region: 8-77
Classification Level Classification E-value
Superfamily Homeodomain-like 2.09e-40
Family Homeodomain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1b8iA   PDB: 1b8i   SUPERFAMILY: 1b8iA
Sequence length 81
Comment (A:)
Sequence
qasnhtfypwmaiagtnglrrrgrqtytryqtlelekefhtnhyltrrrriemahalslt
erqikiwfqnrrmklkkeiqa
Download sequence
Identical sequences cath|current|1b8iA00/88-160 1b8iA 1b8i_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]