SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1b9rA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1b9rA
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.17e-37
Family 2Fe-2S ferredoxin-related 0.0000772
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1b9rA   PDB: 1b9r   SUPERFAMILY: 1b9rA
Sequence length 105
Comment (A:)
Sequence
prvvfideqsgeyavdaqdgqslmevatqngvpgivaecggscvcatcrieiedawveiv
geanpdendllqstgepmtagtrlscqvfidpsmdglivrvplpa
Download sequence
Identical sequences 1b9rA 1b9r_A 000006109|e1b9rA1|221.1.1.12|A:1-105 cath|current|1b9rA00/1-105 d1b9ra_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]