SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ba5A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ba5A
Domain Number 1 Region: 5-51
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000548
Family DNA-binding domain of telomeric protein 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ba5A   PDB: 1ba5   SUPERFAMILY: 1ba5A
Sequence length 53
Comment (A:)
Sequence
rkrqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkkl
Download sequence
Identical sequences 1ba5A cath|current|1ba5A00/1-53 d1ba5a_ 1ba5_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]