SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1bbuA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1bbuA
Domain Number 1 Region: 155-501
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.9e-226
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000102
Further Details:      
 
Domain Number 2 Region: 19-159
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.18e-78
Family Anticodon-binding domain 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1bbuA   PDB: 1bbu
Sequence length 504
Comment (A:)
Sequence
seqhaqgadavvdlnnelktrreklanlreqgiafpndfrrdhtsdqlhaefdgkeneel
ealnievavagrmmtrrimgkasfvtlqdvggriqlyvarddlpegvyneqfkkwdlgdi
lgakgklfktktgelsihctelrlltkalrplpdkfhglqdqearyrqryldlisndesr
ntfkvrsqilsgirqfmvnrgfmevetpmmqvipggaaarpfithhnaldldmylriape
lylkrlvvggfervfeinrnfrnegisvrhnpeftmmelymayadykdlielteslfrtl
aqdilgktevtygdvtldfgkpfekltmreaikkyrpetdmadldnfdsakaiaesigih
vekswglgrivteifeevaeahliqptfiteypaevsplarrndvnpeitdrfeffiggr
eigngfselndaedqaqrfldqvaakdagddeamfydedyvtalehglpptaglgigidr
mvmlftnshtirdvilfpamrpvk
Download sequence
Identical sequences 1bbuA 1bbu_A 1bbw_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]