SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1bc1A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1bc1A
Domain Number 1 Region: 4-318
Classification Level Classification E-value
Superfamily Annexin 1.32e-188
Family Annexin 0.0000000888
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1bc1A   PDB: 1bc1   SUPERFAMILY: 1bc1A
Sequence length 319
Comment (A:)
Sequence
malrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfg
rdlvndmkselkgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeel
raikqayeeeygsnleddvvgdtkgyyqrmlvvllqanrdpdtaiddaqveldaqalfqa
gelkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretkgnlenlllavvk
sirsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikg
dtkgdykkallllcggedd
Download sequence
Identical sequences 1bc1A 1bc1_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]