SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1bc3A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1bc3A
Domain Number 1 Region: 4-318
Classification Level Classification E-value
Superfamily Annexin 2.05e-189
Family Annexin 0.0000000888
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1bc3A   PDB: 1bc3   SUPERFAMILY: 1bc3A
Sequence length 319
Comment (A:)
Sequence
malrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfg
rdlvndmkselkgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeel
raikqayeeeygsnleddvvgdtkgyyqrmlvvllqanrdpdtaiddaqveldaqalfqa
gelkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretkgnlenlllavvk
sirsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikg
dtsgdykkallllcggedd
Download sequence
Identical sequences 1bc3_A 1bc3A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]