SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1bc6A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1bc6A
Domain Number 1 Region: 2-74
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.37e-22
Family 7-Fe ferredoxin 0.0000946
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1bc6A   PDB: 1bc6   SUPERFAMILY: 1bc6A
Sequence length 77
Comment (A:)
Sequence
ayvitepcigtkdascvevcpvdcihegedqyyidpdvcidcgaceavcpvsaiyhedfv
peewksyiqknrdffkk
Download sequence
Identical sequences 1bc6A 1bc6_A 1bd6_A 000067007|e1bd6A1|205.1.1.6|A:1-77 000067009|e1bc6A1|205.1.1.6|A:1-77 cath|current|1bc6A00/1-77 cath|current|1bd6A00/1-77 d1bc6a_ d1bd6a_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]