SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1bcwA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1bcwA
Domain Number 1 Region: 4-318
Classification Level Classification E-value
Superfamily Annexin 1.39e-189
Family Annexin 0.0000000846
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1bcwA   PDB: 1bcw   SUPERFAMILY: 1bcwA
Sequence length 319
Comment (A:)
Sequence
malrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfg
rdlvndmkselagkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeel
raikqayeeeygsnleddvvgdtsgyyqrmlvvllqanrdpdtaiddaqveldaqalfqa
gelkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretsgnlenlllavvk
sirsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikg
dtsgdykkallllcggedd
Download sequence
Identical sequences 1bcw_A 1bcwA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]