SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1biaA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1biaA
Domain Number 1 Region: 69-268
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.98e-59
Family Biotin holoenzyme synthetase 0.0000000066
Further Details:      
 
Domain Number 2 Region: 3-60
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000138
Family Biotin repressor-like 0.0001
Further Details:      
 
Domain Number 3 Region: 271-317
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 0.0000000000849
Family Biotin repressor (BirA) 0.0000889
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1biaA   PDB: 1bia
Sequence length 321
Comment (A:)
Sequence
MKDNTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKGYSL
PEPIQLLNAKQILGQLDGGSVAVLPVIDSTNQYLLDRIGELKSGDACIAEYQQAGRGRRG
RKWFSPFGANLYLSMFWRLEQGPAAAIGLSLVIGIVMAEVLRKLGADKVRVKWPNDLYLQ
DRKLAGILVELTGKTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAA
MLIRELRAALELFEQEGLAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLL
EQDGIIKPWMGGEISLRSAEK
Download sequence
Identical sequences A0A026UT66 A0A069FJV6 A0A069WZW2 A0A070SZR5 A0A0E0U676 A0A0M7PK18 A0A125WU94 A0A1S9JXX7 A0A1X3IE77 A0A1X3J9H9 A0A236H441 A0A2I6QK86 B3X7G1 E3PBU6 E7T0P2 F3VAY4 F3WQT6 F4SS28 G0F9T4 I2XFM5 M9H7Z1 P06709 T9C5L9
gi|387623610|ref|YP_006131238.1| gi|388479291|ref|YP_491483.1| gi|387623610|ref|YP_006131238.1| gi|386616797|ref|YP_006136463.1| gi|471335454|ref|YP_007558931.1| gi|170083438|ref|YP_001732758.1| 1biaA gi|238903034|ref|YP_002928830.1| gi|387614657|ref|YP_006117773.1| gi|16131807|ref|NP_418404.1| 316385.ECDH10B_4162 316407.birA 511145.b3973 595496.BWG_3637 1bia_A 1bib_A 1hxd_A 1hxd_B 2ewn_A 2ewn_B NP_418404.1.90541 WP_000654630.1.100085 WP_000654630.1.100111 WP_000654630.1.100251 WP_000654630.1.100441 WP_000654630.1.100451 WP_000654630.1.100487 WP_000654630.1.10051 WP_000654630.1.100614 WP_000654630.1.100824 WP_000654630.1.10086 WP_000654630.1.100966 WP_000654630.1.101033 WP_000654630.1.101158 WP_000654630.1.101186 WP_000654630.1.101423 WP_000654630.1.101654 WP_000654630.1.101747 WP_000654630.1.101777 WP_000654630.1.10188 WP_000654630.1.10252 WP_000654630.1.10417 WP_000654630.1.10491 WP_000654630.1.10729 WP_000654630.1.10833 WP_000654630.1.11047 WP_000654630.1.11118 WP_000654630.1.1113 WP_000654630.1.11133 WP_000654630.1.11241 WP_000654630.1.11408 WP_000654630.1.11436 WP_000654630.1.11955 WP_000654630.1.11982 WP_000654630.1.11985 WP_000654630.1.1212 WP_000654630.1.12415 WP_000654630.1.12542 WP_000654630.1.12582 WP_000654630.1.12680 WP_000654630.1.12756 WP_000654630.1.12914 WP_000654630.1.13031 WP_000654630.1.1312 WP_000654630.1.13136 WP_000654630.1.13176 WP_000654630.1.13239 WP_000654630.1.13258 WP_000654630.1.13281 WP_000654630.1.13290 WP_000654630.1.13333 WP_000654630.1.1345 WP_000654630.1.13585 WP_000654630.1.13618 WP_000654630.1.13949 WP_000654630.1.14030 WP_000654630.1.1419 WP_000654630.1.14277 WP_000654630.1.14346 WP_000654630.1.1438 WP_000654630.1.14529 WP_000654630.1.1461 WP_000654630.1.14811 WP_000654630.1.14833 WP_000654630.1.1512 WP_000654630.1.15121 WP_000654630.1.15496 WP_000654630.1.15645 WP_000654630.1.15740 WP_000654630.1.15747 WP_000654630.1.1588 WP_000654630.1.16086 WP_000654630.1.1609 WP_000654630.1.16102 WP_000654630.1.16179 WP_000654630.1.16294 WP_000654630.1.1634 WP_000654630.1.16532 WP_000654630.1.16577 WP_000654630.1.16721 WP_000654630.1.16752 WP_000654630.1.17018 WP_000654630.1.17084 WP_000654630.1.17087 WP_000654630.1.17114 WP_000654630.1.17123 WP_000654630.1.17216 WP_000654630.1.17290 WP_000654630.1.17432 WP_000654630.1.17534 WP_000654630.1.1755 WP_000654630.1.17577 WP_000654630.1.17889 WP_000654630.1.17952 WP_000654630.1.18000 WP_000654630.1.18133 WP_000654630.1.18141 WP_000654630.1.18381 WP_000654630.1.18402 WP_000654630.1.18550 WP_000654630.1.18726 WP_000654630.1.18858 WP_000654630.1.18861 WP_000654630.1.18876 WP_000654630.1.19100 WP_000654630.1.19150 WP_000654630.1.19194 WP_000654630.1.19277 WP_000654630.1.193 WP_000654630.1.19313 WP_000654630.1.1963 WP_000654630.1.19644 WP_000654630.1.19684 WP_000654630.1.1982 WP_000654630.1.19889 WP_000654630.1.19940 WP_000654630.1.19957 WP_000654630.1.19994 WP_000654630.1.20151 WP_000654630.1.20318 WP_000654630.1.20331 WP_000654630.1.20445 WP_000654630.1.20506 WP_000654630.1.20536 WP_000654630.1.2063 WP_000654630.1.20638 WP_000654630.1.20724 WP_000654630.1.20737 WP_000654630.1.20943 WP_000654630.1.20982 WP_000654630.1.2100 WP_000654630.1.21033 WP_000654630.1.21057 WP_000654630.1.21122 WP_000654630.1.21251 WP_000654630.1.2142 WP_000654630.1.21470 WP_000654630.1.21573 WP_000654630.1.21661 WP_000654630.1.21733 WP_000654630.1.21758 WP_000654630.1.21771 WP_000654630.1.21823 WP_000654630.1.21915 WP_000654630.1.22060 WP_000654630.1.22113 WP_000654630.1.22363 WP_000654630.1.22450 WP_000654630.1.22574 WP_000654630.1.22579 WP_000654630.1.22632 WP_000654630.1.22669 WP_000654630.1.22690 WP_000654630.1.22830 WP_000654630.1.22878 WP_000654630.1.22885 WP_000654630.1.2300 WP_000654630.1.23044 WP_000654630.1.23090 WP_000654630.1.23511 WP_000654630.1.23945 WP_000654630.1.24045 WP_000654630.1.24089 WP_000654630.1.24124 WP_000654630.1.2418 WP_000654630.1.2428 WP_000654630.1.24362 WP_000654630.1.24583 WP_000654630.1.24695 WP_000654630.1.24899 WP_000654630.1.24960 WP_000654630.1.25141 WP_000654630.1.25324 WP_000654630.1.25525 WP_000654630.1.25643 WP_000654630.1.25713 WP_000654630.1.26048 WP_000654630.1.26379 WP_000654630.1.26443 WP_000654630.1.26480 WP_000654630.1.26588 WP_000654630.1.26609 WP_000654630.1.2694 WP_000654630.1.26941 WP_000654630.1.27057 WP_000654630.1.27134 WP_000654630.1.27451 WP_000654630.1.27560 WP_000654630.1.27742 WP_000654630.1.27879 WP_000654630.1.27923 WP_000654630.1.28128 WP_000654630.1.28268 WP_000654630.1.28271 WP_000654630.1.28371 WP_000654630.1.28509 WP_000654630.1.28662 WP_000654630.1.28697 WP_000654630.1.28711 WP_000654630.1.28760 WP_000654630.1.28919 WP_000654630.1.28982 WP_000654630.1.29016 WP_000654630.1.29061 WP_000654630.1.29100 WP_000654630.1.29128 WP_000654630.1.2942 WP_000654630.1.2945 WP_000654630.1.29746 WP_000654630.1.2995 WP_000654630.1.29967 WP_000654630.1.30004 WP_000654630.1.30231 WP_000654630.1.30247 WP_000654630.1.30472 WP_000654630.1.30479 WP_000654630.1.30497 WP_000654630.1.30554 WP_000654630.1.30630 WP_000654630.1.30639 WP_000654630.1.30749 WP_000654630.1.31000 WP_000654630.1.31211 WP_000654630.1.31379 WP_000654630.1.31407 WP_000654630.1.31419 WP_000654630.1.31421 WP_000654630.1.31614 WP_000654630.1.3169 WP_000654630.1.31833 WP_000654630.1.31839 WP_000654630.1.31978 WP_000654630.1.32091 WP_000654630.1.32121 WP_000654630.1.32127 WP_000654630.1.32143 WP_000654630.1.32479 WP_000654630.1.32509 WP_000654630.1.32815 WP_000654630.1.32903 WP_000654630.1.32984 WP_000654630.1.33014 WP_000654630.1.33325 WP_000654630.1.334 WP_000654630.1.33408 WP_000654630.1.33424 WP_000654630.1.33502 WP_000654630.1.33526 WP_000654630.1.33545 WP_000654630.1.33565 WP_000654630.1.33648 WP_000654630.1.33736 WP_000654630.1.33746 WP_000654630.1.33799 WP_000654630.1.33879 WP_000654630.1.3401 WP_000654630.1.34124 WP_000654630.1.34277 WP_000654630.1.34332 WP_000654630.1.34363 WP_000654630.1.34444 WP_000654630.1.34525 WP_000654630.1.34532 WP_000654630.1.347 WP_000654630.1.34990 WP_000654630.1.34993 WP_000654630.1.35360 WP_000654630.1.35466 WP_000654630.1.35651 WP_000654630.1.35724 WP_000654630.1.35904 WP_000654630.1.35942 WP_000654630.1.35959 WP_000654630.1.36164 WP_000654630.1.3620 WP_000654630.1.36386 WP_000654630.1.36453 WP_000654630.1.36627 WP_000654630.1.36707 WP_000654630.1.3671 WP_000654630.1.36746 WP_000654630.1.36747 WP_000654630.1.37057 WP_000654630.1.37233 WP_000654630.1.37261 WP_000654630.1.37445 WP_000654630.1.37485 WP_000654630.1.37576 WP_000654630.1.37588 WP_000654630.1.3788 WP_000654630.1.37897 WP_000654630.1.37964 WP_000654630.1.38080 WP_000654630.1.38105 WP_000654630.1.3811 WP_000654630.1.3815 WP_000654630.1.38182 WP_000654630.1.38323 WP_000654630.1.38485 WP_000654630.1.38636 WP_000654630.1.38935 WP_000654630.1.38950 WP_000654630.1.38956 WP_000654630.1.39356 WP_000654630.1.39365 WP_000654630.1.39367 WP_000654630.1.39430 WP_000654630.1.39531 WP_000654630.1.39870 WP_000654630.1.39938 WP_000654630.1.39961 WP_000654630.1.39966 WP_000654630.1.40013 WP_000654630.1.40016 WP_000654630.1.40192 WP_000654630.1.40212 WP_000654630.1.40218 WP_000654630.1.40317 WP_000654630.1.40389 WP_000654630.1.40445 WP_000654630.1.40499 WP_000654630.1.40524 WP_000654630.1.40548 WP_000654630.1.40596 WP_000654630.1.406 WP_000654630.1.40712 WP_000654630.1.40815 WP_000654630.1.40833 WP_000654630.1.40898 WP_000654630.1.40912 WP_000654630.1.40965 WP_000654630.1.41206 WP_000654630.1.4126 WP_000654630.1.41363 WP_000654630.1.41368 WP_000654630.1.41436 WP_000654630.1.41484 WP_000654630.1.41530 WP_000654630.1.41556 WP_000654630.1.41621 WP_000654630.1.41782 WP_000654630.1.41813 WP_000654630.1.41900 WP_000654630.1.41988 WP_000654630.1.42022 WP_000654630.1.42113 WP_000654630.1.4214 WP_000654630.1.42209 WP_000654630.1.42214 WP_000654630.1.42376 WP_000654630.1.4242 WP_000654630.1.42432 WP_000654630.1.42547 WP_000654630.1.42632 WP_000654630.1.42669 WP_000654630.1.42879 WP_000654630.1.42936 WP_000654630.1.43174 WP_000654630.1.43489 WP_000654630.1.43720 WP_000654630.1.44040 WP_000654630.1.44096 WP_000654630.1.44115 WP_000654630.1.44162 WP_000654630.1.44166 WP_000654630.1.44365 WP_000654630.1.44458 WP_000654630.1.44461 WP_000654630.1.44558 WP_000654630.1.44724 WP_000654630.1.44821 WP_000654630.1.44854 WP_000654630.1.44960 WP_000654630.1.44970 WP_000654630.1.44980 WP_000654630.1.45028 WP_000654630.1.45043 WP_000654630.1.4516 WP_000654630.1.45208 WP_000654630.1.45246 WP_000654630.1.45581 WP_000654630.1.45595 WP_000654630.1.4574 WP_000654630.1.45933 WP_000654630.1.46026 WP_000654630.1.46115 WP_000654630.1.46186 WP_000654630.1.46213 WP_000654630.1.46329 WP_000654630.1.46582 WP_000654630.1.46802 WP_000654630.1.46820 WP_000654630.1.46821 WP_000654630.1.46932 WP_000654630.1.47038 WP_000654630.1.47048 WP_000654630.1.47156 WP_000654630.1.47171 WP_000654630.1.4722 WP_000654630.1.47224 WP_000654630.1.47401 WP_000654630.1.47414 WP_000654630.1.47496 WP_000654630.1.47555 WP_000654630.1.47634 WP_000654630.1.47646 WP_000654630.1.4772 WP_000654630.1.47734 WP_000654630.1.47765 WP_000654630.1.47791 WP_000654630.1.48040 WP_000654630.1.48096 WP_000654630.1.48111 WP_000654630.1.48194 WP_000654630.1.48200 WP_000654630.1.48290 WP_000654630.1.48353 WP_000654630.1.4871 WP_000654630.1.48953 WP_000654630.1.48974 WP_000654630.1.49009 WP_000654630.1.49243 WP_000654630.1.49363 WP_000654630.1.49531 WP_000654630.1.49537 WP_000654630.1.49645 WP_000654630.1.49733 WP_000654630.1.49900 WP_000654630.1.50006 WP_000654630.1.50008 WP_000654630.1.50078 WP_000654630.1.5017 WP_000654630.1.50262 WP_000654630.1.50452 WP_000654630.1.50579 WP_000654630.1.5067 WP_000654630.1.50957 WP_000654630.1.51042 WP_000654630.1.5106 WP_000654630.1.51172 WP_000654630.1.51495 WP_000654630.1.51539 WP_000654630.1.51552 WP_000654630.1.51587 WP_000654630.1.51784 WP_000654630.1.52020 WP_000654630.1.52076 WP_000654630.1.52127 WP_000654630.1.52186 WP_000654630.1.52211 WP_000654630.1.52214 WP_000654630.1.52243 WP_000654630.1.52305 WP_000654630.1.52399 WP_000654630.1.52492 WP_000654630.1.52544 WP_000654630.1.52558 WP_000654630.1.5265 WP_000654630.1.52774 WP_000654630.1.52780 WP_000654630.1.52853 WP_000654630.1.52895 WP_000654630.1.53012 WP_000654630.1.53020 WP_000654630.1.53027 WP_000654630.1.53327 WP_000654630.1.53428 WP_000654630.1.53545 WP_000654630.1.53594 WP_000654630.1.53645 WP_000654630.1.53769 WP_000654630.1.53931 WP_000654630.1.53972 WP_000654630.1.53994 WP_000654630.1.54002 WP_000654630.1.54329 WP_000654630.1.54344 WP_000654630.1.54463 WP_000654630.1.54507 WP_000654630.1.5460 WP_000654630.1.54602 WP_000654630.1.54605 WP_000654630.1.5461 WP_000654630.1.54617 WP_000654630.1.54620 WP_000654630.1.5470 WP_000654630.1.54769 WP_000654630.1.54981 WP_000654630.1.55005 WP_000654630.1.55123 WP_000654630.1.55374 WP_000654630.1.55425 WP_000654630.1.55466 WP_000654630.1.55529 WP_000654630.1.55551 WP_000654630.1.55556 WP_000654630.1.55629 WP_000654630.1.55676 WP_000654630.1.55720 WP_000654630.1.55825 WP_000654630.1.55868 WP_000654630.1.5614 WP_000654630.1.56164 WP_000654630.1.56390 WP_000654630.1.56786 WP_000654630.1.56799 WP_000654630.1.56934 WP_000654630.1.56978 WP_000654630.1.57181 WP_000654630.1.57386 WP_000654630.1.57401 WP_000654630.1.57410 WP_000654630.1.57414 WP_000654630.1.57432 WP_000654630.1.5755 WP_000654630.1.57629 WP_000654630.1.57846 WP_000654630.1.5786 WP_000654630.1.58060 WP_000654630.1.58080 WP_000654630.1.58232 WP_000654630.1.58316 WP_000654630.1.58384 WP_000654630.1.58401 WP_000654630.1.5842 WP_000654630.1.58420 WP_000654630.1.58429 WP_000654630.1.58440 WP_000654630.1.58837 WP_000654630.1.58867 WP_000654630.1.58951 WP_000654630.1.58976 WP_000654630.1.59024 WP_000654630.1.59306 WP_000654630.1.59407 WP_000654630.1.59513 WP_000654630.1.59553 WP_000654630.1.59615 WP_000654630.1.59998 WP_000654630.1.6002 WP_000654630.1.60031 WP_000654630.1.60505 WP_000654630.1.60550 WP_000654630.1.60576 WP_000654630.1.6061 WP_000654630.1.6066 WP_000654630.1.60717 WP_000654630.1.60764 WP_000654630.1.60901 WP_000654630.1.61005 WP_000654630.1.61058 WP_000654630.1.6106 WP_000654630.1.61096 WP_000654630.1.61102 WP_000654630.1.61170 WP_000654630.1.61505 WP_000654630.1.61517 WP_000654630.1.61663 WP_000654630.1.61779 WP_000654630.1.61822 WP_000654630.1.61949 WP_000654630.1.62099 WP_000654630.1.62612 WP_000654630.1.62642 WP_000654630.1.62735 WP_000654630.1.62750 WP_000654630.1.62787 WP_000654630.1.62919 WP_000654630.1.62989 WP_000654630.1.63167 WP_000654630.1.63246 WP_000654630.1.6337 WP_000654630.1.63453 WP_000654630.1.63478 WP_000654630.1.64008 WP_000654630.1.64040 WP_000654630.1.6416 WP_000654630.1.64285 WP_000654630.1.64355 WP_000654630.1.64380 WP_000654630.1.64448 WP_000654630.1.64749 WP_000654630.1.64784 WP_000654630.1.64789 WP_000654630.1.64912 WP_000654630.1.65040 WP_000654630.1.65271 WP_000654630.1.65353 WP_000654630.1.65364 WP_000654630.1.65596 WP_000654630.1.65961 WP_000654630.1.66050 WP_000654630.1.66104 WP_000654630.1.66105 WP_000654630.1.66327 WP_000654630.1.6635 WP_000654630.1.66387 WP_000654630.1.66389 WP_000654630.1.66395 WP_000654630.1.6645 WP_000654630.1.66501 WP_000654630.1.6654 WP_000654630.1.66559 WP_000654630.1.66624 WP_000654630.1.66719 WP_000654630.1.66933 WP_000654630.1.67022 WP_000654630.1.67137 WP_000654630.1.67293 WP_000654630.1.67415 WP_000654630.1.67538 WP_000654630.1.67732 WP_000654630.1.67786 WP_000654630.1.67787 WP_000654630.1.67853 WP_000654630.1.67975 WP_000654630.1.68008 WP_000654630.1.6803 WP_000654630.1.6814 WP_000654630.1.68170 WP_000654630.1.68341 WP_000654630.1.68534 WP_000654630.1.68697 WP_000654630.1.68711 WP_000654630.1.68797 WP_000654630.1.68865 WP_000654630.1.69126 WP_000654630.1.6916 WP_000654630.1.69258 WP_000654630.1.69303 WP_000654630.1.69305 WP_000654630.1.69473 WP_000654630.1.69646 WP_000654630.1.69803 WP_000654630.1.70407 WP_000654630.1.70578 WP_000654630.1.70619 WP_000654630.1.70767 WP_000654630.1.70794 WP_000654630.1.70880 WP_000654630.1.71024 WP_000654630.1.71159 WP_000654630.1.71229 WP_000654630.1.71272 WP_000654630.1.71312 WP_000654630.1.71323 WP_000654630.1.71397 WP_000654630.1.71403 WP_000654630.1.71409 WP_000654630.1.71480 WP_000654630.1.71522 WP_000654630.1.71837 WP_000654630.1.71938 WP_000654630.1.71944 WP_000654630.1.71975 WP_000654630.1.71993 WP_000654630.1.72033 WP_000654630.1.7210 WP_000654630.1.72157 WP_000654630.1.72184 WP_000654630.1.72237 WP_000654630.1.72279 WP_000654630.1.72337 WP_000654630.1.72397 WP_000654630.1.72485 WP_000654630.1.72511 WP_000654630.1.72537 WP_000654630.1.72606 WP_000654630.1.72616 WP_000654630.1.72745 WP_000654630.1.72747 WP_000654630.1.72837 WP_000654630.1.72860 WP_000654630.1.72869 WP_000654630.1.72910 WP_000654630.1.73085 WP_000654630.1.73129 WP_000654630.1.73217 WP_000654630.1.73292 WP_000654630.1.73295 WP_000654630.1.73385 WP_000654630.1.73524 WP_000654630.1.73717 WP_000654630.1.73835 WP_000654630.1.73843 WP_000654630.1.73844 WP_000654630.1.73859 WP_000654630.1.73942 WP_000654630.1.7411 WP_000654630.1.74123 WP_000654630.1.7413 WP_000654630.1.74309 WP_000654630.1.74365 WP_000654630.1.74445 WP_000654630.1.74528 WP_000654630.1.7461 WP_000654630.1.74625 WP_000654630.1.74688 WP_000654630.1.74691 WP_000654630.1.74713 WP_000654630.1.7475 WP_000654630.1.74962 WP_000654630.1.75139 WP_000654630.1.75145 WP_000654630.1.75149 WP_000654630.1.75243 WP_000654630.1.75272 WP_000654630.1.75491 WP_000654630.1.75537 WP_000654630.1.75612 WP_000654630.1.75644 WP_000654630.1.75679 WP_000654630.1.75687 WP_000654630.1.75699 WP_000654630.1.75983 WP_000654630.1.75995 WP_000654630.1.76009 WP_000654630.1.76039 WP_000654630.1.76196 WP_000654630.1.76312 WP_000654630.1.76361 WP_000654630.1.76446 WP_000654630.1.76462 WP_000654630.1.76701 WP_000654630.1.76815 WP_000654630.1.76909 WP_000654630.1.77214 WP_000654630.1.77291 WP_000654630.1.77358 WP_000654630.1.77470 WP_000654630.1.77595 WP_000654630.1.77636 WP_000654630.1.77648 WP_000654630.1.77768 WP_000654630.1.77876 WP_000654630.1.77949 WP_000654630.1.78000 WP_000654630.1.78089 WP_000654630.1.78196 WP_000654630.1.78321 WP_000654630.1.78413 WP_000654630.1.7847 WP_000654630.1.78583 WP_000654630.1.78612 WP_000654630.1.78750 WP_000654630.1.78953 WP_000654630.1.79004 WP_000654630.1.79086 WP_000654630.1.79246 WP_000654630.1.79505 WP_000654630.1.79558 WP_000654630.1.79764 WP_000654630.1.79840 WP_000654630.1.7987 WP_000654630.1.79871 WP_000654630.1.79984 WP_000654630.1.80060 WP_000654630.1.80136 WP_000654630.1.80255 WP_000654630.1.80320 WP_000654630.1.80428 WP_000654630.1.80440 WP_000654630.1.80517 WP_000654630.1.80524 WP_000654630.1.8057 WP_000654630.1.80626 WP_000654630.1.80662 WP_000654630.1.80666 WP_000654630.1.80768 WP_000654630.1.80804 WP_000654630.1.80805 WP_000654630.1.80884 WP_000654630.1.8090 WP_000654630.1.81034 WP_000654630.1.81054 WP_000654630.1.81286 WP_000654630.1.81313 WP_000654630.1.81577 WP_000654630.1.81589 WP_000654630.1.81618 WP_000654630.1.81715 WP_000654630.1.81806 WP_000654630.1.81939 WP_000654630.1.82316 WP_000654630.1.8235 WP_000654630.1.82439 WP_000654630.1.82700 WP_000654630.1.82715 WP_000654630.1.82754 WP_000654630.1.83020 WP_000654630.1.8308 WP_000654630.1.831 WP_000654630.1.83140 WP_000654630.1.83205 WP_000654630.1.83224 WP_000654630.1.83735 WP_000654630.1.83941 WP_000654630.1.8411 WP_000654630.1.84331 WP_000654630.1.84405 WP_000654630.1.84410 WP_000654630.1.8444 WP_000654630.1.84534 WP_000654630.1.84584 WP_000654630.1.84697 WP_000654630.1.8470 WP_000654630.1.84738 WP_000654630.1.84875 WP_000654630.1.84977 WP_000654630.1.84989 WP_000654630.1.84994 WP_000654630.1.85002 WP_000654630.1.85216 WP_000654630.1.85247 WP_000654630.1.85255 WP_000654630.1.85260 WP_000654630.1.85310 WP_000654630.1.85621 WP_000654630.1.8592 WP_000654630.1.86001 WP_000654630.1.86161 WP_000654630.1.8621 WP_000654630.1.86412 WP_000654630.1.86461 WP_000654630.1.86475 WP_000654630.1.86583 WP_000654630.1.86609 WP_000654630.1.86691 WP_000654630.1.86787 WP_000654630.1.86956 WP_000654630.1.86959 WP_000654630.1.86997 WP_000654630.1.87199 WP_000654630.1.87389 WP_000654630.1.87557 WP_000654630.1.87574 WP_000654630.1.87655 WP_000654630.1.87721 WP_000654630.1.87857 WP_000654630.1.87919 WP_000654630.1.88017 WP_000654630.1.88088 WP_000654630.1.88110 WP_000654630.1.88155 WP_000654630.1.88304 WP_000654630.1.88434 WP_000654630.1.88729 WP_000654630.1.88757 WP_000654630.1.8879 WP_000654630.1.88834 WP_000654630.1.89090 WP_000654630.1.89099 WP_000654630.1.894 WP_000654630.1.89416 WP_000654630.1.89458 WP_000654630.1.89468 WP_000654630.1.89471 WP_000654630.1.89674 WP_000654630.1.89899 WP_000654630.1.89923 WP_000654630.1.90017 WP_000654630.1.90078 WP_000654630.1.90168 WP_000654630.1.90256 WP_000654630.1.90358 WP_000654630.1.9036 WP_000654630.1.90511 WP_000654630.1.90520 WP_000654630.1.90536 WP_000654630.1.90951 WP_000654630.1.91277 WP_000654630.1.91340 WP_000654630.1.91341 WP_000654630.1.91445 WP_000654630.1.91462 WP_000654630.1.915 WP_000654630.1.91551 WP_000654630.1.91643 WP_000654630.1.9169 WP_000654630.1.91739 WP_000654630.1.91850 WP_000654630.1.92161 WP_000654630.1.92496 WP_000654630.1.92568 WP_000654630.1.92614 WP_000654630.1.92615 WP_000654630.1.9264 WP_000654630.1.92708 WP_000654630.1.92719 WP_000654630.1.92742 WP_000654630.1.92845 WP_000654630.1.92943 WP_000654630.1.93019 WP_000654630.1.93054 WP_000654630.1.93175 WP_000654630.1.93276 WP_000654630.1.93312 WP_000654630.1.93629 WP_000654630.1.93652 WP_000654630.1.93673 WP_000654630.1.93755 WP_000654630.1.93911 WP_000654630.1.94025 WP_000654630.1.94176 WP_000654630.1.94271 WP_000654630.1.94388 WP_000654630.1.94445 WP_000654630.1.9457 WP_000654630.1.94738 WP_000654630.1.94764 WP_000654630.1.948 WP_000654630.1.9489 WP_000654630.1.94898 WP_000654630.1.94903 WP_000654630.1.94949 WP_000654630.1.94993 WP_000654630.1.95332 WP_000654630.1.95395 WP_000654630.1.95595 WP_000654630.1.95800 WP_000654630.1.95827 WP_000654630.1.95849 WP_000654630.1.95919 WP_000654630.1.95932 WP_000654630.1.96215 WP_000654630.1.96299 WP_000654630.1.96303 WP_000654630.1.96339 WP_000654630.1.96394 WP_000654630.1.9690 WP_000654630.1.9691 WP_000654630.1.97119 WP_000654630.1.97123 WP_000654630.1.97231 WP_000654630.1.97418 WP_000654630.1.97439 WP_000654630.1.97560 WP_000654630.1.97677 WP_000654630.1.97825 WP_000654630.1.97982 WP_000654630.1.97996 WP_000654630.1.98220 WP_000654630.1.98235 WP_000654630.1.98294 WP_000654630.1.98355 WP_000654630.1.98424 WP_000654630.1.98442 WP_000654630.1.98578 WP_000654630.1.98628 WP_000654630.1.9864 WP_000654630.1.98776 WP_000654630.1.98849 WP_000654630.1.99265 WP_000654630.1.99319 WP_000654630.1.99392 WP_000654630.1.99453 WP_000654630.1.99602 eco002003941.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]