SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1bkeA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1bkeA
Domain Number 1 Region: 197-375
Classification Level Classification E-value
Superfamily Serum albumin-like 5.27e-77
Family Serum albumin-like 0.00056
Further Details:      
 
Domain Number 2 Region: 386-573
Classification Level Classification E-value
Superfamily Serum albumin-like 5.96e-74
Family Serum albumin-like 0.00067
Further Details:      
 
Domain Number 3 Region: 3-183
Classification Level Classification E-value
Superfamily Serum albumin-like 1.08e-69
Family Serum albumin-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1bkeA   PDB: 1bke
Sequence length 581
Comment (A:)
Sequence
ksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencd
kslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdvm
ctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkld
elrdegkassakqrlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvht
ecchgdllecaddradlakyicenqdsissklkeccekpllekshciaevendempadlp
slaadfveskdvcknyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaa
adphecyakvfdefkplveepqnlikqncelfeqlgeykfqnallvrytkkvpqvstptl
vevsrnlgkvgskcckhpeakrmpcaedylsvvlnqlcvlhektpvsdrvtkccteslvn
rrpcfsalevdetyvpkefnaetftfhadictlsekerqikkqtalvelvkhkpkatkeq
lkavmddfaafvekcckaddketcfaeegkklvaasqaalg
Download sequence
Identical sequences 1bke_A 1bkeA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]