SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1bo9A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1bo9A
Domain Number 1 Region: 2-73
Classification Level Classification E-value
Superfamily Annexin 2.34e-34
Family Annexin 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1bo9A   PDB: 1bo9   SUPERFAMILY: 1bo9A
Sequence length 73
Comment (A:)
Sequence
tfnpssdvaalhkaimvkgvdeatiidiltkrnnaqrqqikaaylqetgkpldetlkkal
tghleevvlallk
Download sequence
Identical sequences 000003213|e1bo9A1|176.1.1.1|A:1-73 cath|current|1bo9A00/1-73 d1bo9a_ 1bo9_A 1bo9A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]