SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1bpeA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1bpeA
Domain Number 1 Region: 153-333
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.87e-67
Family DNA polymerase beta-like 0.0000000289
Further Details:      
 
Domain Number 2 Region: 4-87
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 7.32e-33
Family DNA polymerase beta, N-terminal domain-like 0.0000136
Further Details:      
 
Domain Number 3 Region: 92-147
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 1.28e-16
Family DNA polymerase beta-like, second domain 0.0000638
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1bpeA   PDB: 1bpe
Sequence length 335
Comment (A:)
Sequence
mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak
klpgvgtkiaekideflatgklrklekirrddtsssinfltrvtgigpsaarklvdegik
tledlrknedklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgs
frrgaessgdmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcq
lpsendeneyphrridirlipkdqyycgvlyftgsdifnknmrahalekgftineytirp
lgvtgvageplpvdseqdifdyiqwryrepkdrse
Download sequence
Identical sequences 1bpe_A 1bpeA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]