SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1buoA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1buoA
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily POZ domain 4.27e-31
Family BTB/POZ domain 0.000009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1buoA   PDB: 1buo   SUPERFAMILY: 1buoA
Sequence length 121
Comment (A:)
Sequence
mgmiqlqnpshptgllckanqmrlagtlcdvvimvdsqefhahrtvlactskmfeilfhr
nsqhytldflspktfqqileyaytatlqakaedlddllyaaeileieyleeqclkmleti
q
Download sequence
Identical sequences 1buoA 000006264|e1buoA1|226.1.1.1|A:1-121 cath|current|1buoA00/6-126 d1buoa_ 1buo_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]