SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1bw6A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1bw6A
Domain Number 1 Region: 1-55
Classification Level Classification E-value
Superfamily Homeodomain-like 2.05e-17
Family Centromere-binding 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1bw6A   PDB: 1bw6   SUPERFAMILY: 1bw6A
Sequence length 56
Comment (A:)
Sequence
mgpkrrqltfreksriiqeveenpdlrkgeiarrfnippstlstilknkrailase
Download sequence
Identical sequences 1bw6A my_001000013.1 000045322|e1bw6A1|101.1.1.4|A:1-56 cath|current|1bw6A00/1-56 d1bw6a_ 1bw6_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]