SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1bxuA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1bxuA
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily Cupredoxins 4.01e-29
Family Plastocyanin/azurin-like 0.0000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1bxuA   PDB: 1bxu   SUPERFAMILY: 1bxuA
Sequence length 91
Comment (A:)
Sequence
qtvaikmgadngmlafepstieiqagdtvqwvnnklaphnvvvegqpelshkdlafspge
tfeatfsepgtytyycephrgagmvgkivvq
Download sequence
Identical sequences 000039320|e1bxuA1|3156.1.1.1|A:1-91 000039336|e1bxvA1|3156.1.1.1|A:1-91 cath|current|1bxuA00/-2-99 cath|current|1bxvA00/-2-99 d1bxua_ d1bxva_ 1bxu_A 1bxv_A 1bxuA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]