SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1c0aA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1c0aA
Domain Number 1 Region: 121-305,397-556
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.82e-184
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000000642
Further Details:      
 
Domain Number 2 Region: 2-105
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.41e-59
Family Anticodon-binding domain 0.00000884
Further Details:      
 
Domain Number 3 Region: 288-419
Classification Level Classification E-value
Superfamily GAD domain-like 9.76e-47
Family GAD domain 0.000000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1c0aA   PDB: 1c0a
Sequence length 585
Comment (A:)
Sequence
mrteycgqlrlshvgqqvtlcgwvnrrrdlgslifidmrdregivqvffdpdradalkla
selrnefciqvtgtvrardekninrdmatgeievlassltiinradvlpldsnhvnteea
rlkyryldlrrpemaqrlktrakitslvrrfmddhgfldietpmltkatpegardylvps
rvhkgkfyalpqspqlfkqllmmsgfdryyqivkcfrdedlradrqpeftqidvetsfmt
apqvrevmealvrhlwlevkgvdlgdfpvmtfaeaerrygsdkpdlrnpmeltdvadllk
svefavfagpandpkgrvaalrvpggasltrkqideygnfvkiygakglayikvnerakg
leginspvakflnaeiiedildrtaaqdgdmiffgadnkkivadamgalrlkvgkdlglt
deskwaplwvidfpmfeddgeggltamhhpftspkdmtaaelkaapenavanaydmving
yevgggsvrihngdmqqtvfgilgineeeqrekfgflldalkygtpphaglafgldrltm
lltgtdnirdviafpkttaaaclmteapsfanptalaelsiqvvk
Download sequence
Identical sequences 1c0aA 1c0a_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]