SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1c0pA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1c0pA
Domain Number 1 Region: 2-209,276-292,328-359
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.91e-40
Family D-aminoacid oxidase, N-terminal domain 0.00000000556
Further Details:      
 
Domain Number 2 Region: 198-290
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.64e-24
Family D-aminoacid oxidase-like 0.00000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1c0pA   PDB: 1c0p
Sequence length 363
Comment (A:)
Sequence
lmmhsqkrvvvlgsgviglssalilarkgysvhilardlpedvssqtfaspwaganwtpf
mtltdgprqakweestfkkwvelvptghamwlkgtrrfaqnedgllghwykditpnyrpl
pssecppgaigvtydtlsvhapkycqylarelqklgatferrtvtsleqafdgadlvvna
tglgaksiagiddqaaepirgqtvlvkspckrctmdssdpaspayiiprpggevicggty
gvgdwdlsvnpetvqrilkhclrldptissdgtiegievlrhnvglrparrggprveaer
ivlpldrtksplslgrgsaraakekevtlvhaygfssagyqqswgaaedvaqlvdeafqr
yhg
Download sequence
Identical sequences 1c0pA 1c0i_A 1c0k_A 1c0l_A 1c0p_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]