SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1cdzA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1cdzA
Domain Number 1 Region: 2-92
Classification Level Classification E-value
Superfamily BRCT domain 2.4e-24
Family DNA-repair protein XRCC1 0.00000643
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1cdzA   PDB: 1cdz   SUPERFAMILY: 1cdzA
Sequence length 96
Comment (A:)
Sequence
elpdffqgkhfflygefpgderrkliryvtafngeledymsdrvqfvitaqewdpsfeea
lmdnpslafvrprwiyscnekqkllphqlygvvpqa
Download sequence
Identical sequences 000010619|e1cdzA1|2111.68.1.11|A:1-96 cath|current|1cdzA00/1-96 d1cdza_ 1cdz_A 1cdzA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]