SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1cfeA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1cfeA
Domain Number 1 Region: 4-135
Classification Level Classification E-value
Superfamily PR-1-like 5.71e-65
Family PR-1-like 0.00000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1cfeA   PDB: 1cfe   SUPERFAMILY: 1cfeA
Sequence length 135
Comment (A:)
Sequence
qnspqdylavhndaraqvgvgpmswdanlasraqnyansragdcnlihsgagenlakggg
dftgraavqlwvserpsynyatnqcvggkkcrhytqvvwrnsvrlgcgrarcnngwwfis
cnydpvgnwigqrpy
Download sequence
Identical sequences 1cfeA 1cfe_A 000006930|e1cfeA1|273.1.1.2|A:1-135 cath|current|1cfeA00/1-135 d1cfea_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]