SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1chdA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1chdA
Domain Number 1 Region: 10-196
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 8.78e-77
Family Methylesterase CheB, C-terminal domain 0.00000000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1chdA   PDB: 1chd   SUPERFAMILY: 1chdA
Sequence length 203
Comment (A:)
Sequence
lkagpllssekliaigastggteairhvlqplplsspaviitqhmppgftrsfaerlnkl
cqisvkeaedgervlpghayiapgdkhmelarsganyqikihdgppvnrhrpsvdvlfhs
vakhagrnavgviltgmgndgaagmlamyqagawtiaqneascvvfgmpreainmggvse
vvdlsqvsqqmlakisagqairi
Download sequence
Identical sequences 1chd_A 1chdA cath|current|1chdA00/152-349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]